Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MK848_RS08450 Genome accession   NZ_CP092824
Coordinates   1642588..1642728 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain S1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1637588..1647728
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MK848_RS08425 (MK848_08420) yuxO 1637864..1638244 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  MK848_RS08430 (MK848_08425) comA 1638263..1638907 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  MK848_RS08435 (MK848_08430) comP 1638988..1641300 (-) 2313 WP_047183111.1 histidine kinase Regulator
  MK848_RS08440 (MK848_08435) comX 1641316..1641537 (-) 222 WP_014114983.1 competence pheromone ComX -
  MK848_RS08445 (MK848_08440) - 1641534..1642403 (-) 870 WP_161476745.1 polyprenyl synthetase family protein -
  MK848_RS08450 (MK848_08445) degQ 1642588..1642728 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  MK848_RS08455 (MK848_08450) - 1642950..1643075 (+) 126 WP_003228793.1 hypothetical protein -
  MK848_RS08460 (MK848_08455) - 1643189..1643557 (+) 369 WP_003243784.1 hypothetical protein -
  MK848_RS08465 (MK848_08460) pdeH 1643533..1644762 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  MK848_RS08470 (MK848_08465) pncB 1644899..1646371 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  MK848_RS08475 (MK848_08470) pncA 1646387..1646938 (-) 552 WP_088326850.1 cysteine hydrolase family protein -
  MK848_RS08480 (MK848_08475) yueI 1647035..1647433 (-) 399 WP_015251331.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=660431 MK848_RS08450 WP_003220708.1 1642588..1642728(-) (degQ) [Bacillus subtilis strain S1]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=660431 MK848_RS08450 WP_003220708.1 1642588..1642728(-) (degQ) [Bacillus subtilis strain S1]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1