Detailed information    

insolico Bioinformatically predicted

Overview


Name   comC/blpC   Type   Regulator
Locus tag   SMUNUM_RS08955 Genome accession   NZ_AP014571
Coordinates   1812423..1812563 (+) Length   46 a.a.
NCBI ID   WP_002270250.1    Uniprot ID   Q9APK7
Organism   Streptococcus mutans LP13     
Function   binding to ComD; induce autophosphorylation of ComD; regulation of comX expression (predicted from homology)   
Competence regulation

Genomic Context


Location: 1807423..1817563
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SMUNUM_RS08925 (SMNUM_1694) - 1808287..1808439 (+) 153 WP_002263741.1 hypothetical protein -
  SMUNUM_RS08930 (SMNUM_1695) - 1808506..1808649 (+) 144 WP_002263740.1 hypothetical protein -
  SMUNUM_RS08935 (SMNUM_1696) comB 1808910..1809923 (-) 1014 WP_002296717.1 HlyD family efflux transporter periplasmic adaptor subunit Regulator
  SMUNUM_RS08940 (SMNUM_1697) - 1809936..1810482 (-) 547 Protein_1715 ATP-binding cassette domain-containing protein -
  SMUNUM_RS08945 (SMNUM_1698) - 1811396..1811797 (-) 402 WP_002310604.1 hypothetical protein -
  SMUNUM_RS08950 (SMNUM_1699) cipB 1811928..1812158 (-) 231 WP_002265368.1 Blp family class II bacteriocin Regulator
  SMUNUM_RS08955 (SMNUM_1700) comC/blpC 1812423..1812563 (+) 141 WP_002270250.1 ComC/BlpC family leader-containing pheromone/bacteriocin Regulator
  SMUNUM_RS08960 (SMNUM_1701) comD/blpH 1812705..1814030 (-) 1326 WP_002267940.1 GHKL domain-containing protein Regulator
  SMUNUM_RS08965 (SMNUM_1702) comE/blpR 1814027..1814779 (-) 753 WP_002270252.1 response regulator transcription factor Regulator
  SMUNUM_RS08970 (SMNUM_1703) - 1815250..1815888 (-) 639 WP_002271525.1 VTT domain-containing protein -
  SMUNUM_RS08975 (SMNUM_1704) - 1815936..1816562 (-) 627 WP_002265453.1 hypothetical protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5195.02 Da        Isoelectric Point: 10.4929

>NTDB_id=65998 SMUNUM_RS08955 WP_002270250.1 1812423..1812563(+) (comC/blpC) [Streptococcus mutans LP13]
MKKTPSLKNDFKEIKTDELEIIIGGSGSLSTFFRLFNRSFTQALGK

Nucleotide


Download         Length: 141 bp        

>NTDB_id=65998 SMUNUM_RS08955 WP_002270250.1 1812423..1812563(+) (comC/blpC) [Streptococcus mutans LP13]
ATGAAAAAAACACCATCATTAAAAAATGACTTTAAAGAAATTAAGACTGATGAATTAGAGATTATCATTGGCGGAAGCGG
AAGCCTATCAACATTTTTCCGGCTGTTTAACAGAAGTTTTACACAAGCTTTGGGAAAATAA

Domains


Predicted by InterproScan.

(1-32)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q9APK7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comC/blpC Streptococcus mutans UA159

97.826

100

0.978


Multiple sequence alignment