Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   MKW31_RS14900 Genome accession   NZ_CP092715
Coordinates   3070764..3070904 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain 37-1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3065764..3075904
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MKW31_RS14875 (MKW31_14825) - 3066060..3066443 (-) 384 WP_032869799.1 hotdog fold thioesterase -
  MKW31_RS14880 (MKW31_14830) comA 3066465..3067109 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  MKW31_RS14885 (MKW31_14835) comP 3067190..3069499 (-) 2310 WP_033574914.1 histidine kinase Regulator
  MKW31_RS14890 (MKW31_14840) comX 3069519..3069695 (-) 177 WP_007408675.1 competence pheromone ComX -
  MKW31_RS14895 (MKW31_14845) comQ 3069695..3070633 (-) 939 WP_020954300.1 polyprenyl synthetase family protein Regulator
  MKW31_RS14900 (MKW31_14850) degQ 3070764..3070904 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  MKW31_RS14905 (MKW31_14855) - 3071370..3071711 (+) 342 WP_007408677.1 hypothetical protein -
  MKW31_RS14910 (MKW31_14860) - 3071718..3072941 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  MKW31_RS14915 (MKW31_14865) - 3073071..3074537 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  MKW31_RS14920 (MKW31_14870) - 3074555..3075106 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  MKW31_RS14925 (MKW31_14875) - 3075203..3075601 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=659865 MKW31_RS14900 WP_003152043.1 3070764..3070904(-) (degQ) [Bacillus velezensis strain 37-1]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=659865 MKW31_RS14900 WP_003152043.1 3070764..3070904(-) (degQ) [Bacillus velezensis strain 37-1]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCTATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891