Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   MKW31_RS11860 Genome accession   NZ_CP092715
Coordinates   2499960..2500337 (-) Length   125 a.a.
NCBI ID   WP_015417814.1    Uniprot ID   -
Organism   Bacillus velezensis strain 37-1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2494960..2505337
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MKW31_RS11820 (MKW31_11800) - 2495458..2496252 (+) 795 WP_007408330.1 YqhG family protein -
  MKW31_RS11825 (MKW31_11805) sinI 2496429..2496602 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  MKW31_RS11830 (MKW31_11810) sinR 2496636..2496971 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  MKW31_RS11835 (MKW31_11815) - 2497019..2497804 (-) 786 WP_007408329.1 TasA family protein -
  MKW31_RS11840 (MKW31_11820) - 2497869..2498453 (-) 585 WP_015240205.1 signal peptidase I -
  MKW31_RS11845 (MKW31_11825) tapA 2498425..2499096 (-) 672 WP_015417813.1 amyloid fiber anchoring/assembly protein TapA -
  MKW31_RS11850 (MKW31_11830) - 2499355..2499684 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  MKW31_RS11855 (MKW31_11835) - 2499724..2499903 (-) 180 WP_003153093.1 YqzE family protein -
  MKW31_RS11860 (MKW31_11840) comGG 2499960..2500337 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  MKW31_RS11865 (MKW31_11845) comGF 2500338..2500838 (-) 501 WP_254922226.1 competence type IV pilus minor pilin ComGF -
  MKW31_RS11870 (MKW31_11850) comGE 2500747..2501061 (-) 315 WP_094032244.1 competence type IV pilus minor pilin ComGE -
  MKW31_RS11875 (MKW31_11855) comGD 2501045..2501482 (-) 438 WP_094032243.1 competence type IV pilus minor pilin ComGD Machinery gene
  MKW31_RS11880 (MKW31_11860) comGC 2501472..2501780 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  MKW31_RS11885 (MKW31_11865) comGB 2501785..2502822 (-) 1038 WP_015417819.1 competence type IV pilus assembly protein ComGB Machinery gene
  MKW31_RS11890 (MKW31_11870) comGA 2502809..2503879 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  MKW31_RS11895 (MKW31_11875) - 2504072..2505022 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14167.09 Da        Isoelectric Point: 9.7165

>NTDB_id=659845 MKW31_RS11860 WP_015417814.1 2499960..2500337(-) (comGG) [Bacillus velezensis strain 37-1]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=659845 MKW31_RS11860 WP_015417814.1 2499960..2500337(-) (comGG) [Bacillus velezensis strain 37-1]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
CTCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGTACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504