Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   MKW31_RS11825 Genome accession   NZ_CP092715
Coordinates   2496429..2496602 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain 37-1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2491429..2501602
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MKW31_RS11810 (MKW31_11790) gcvT 2492242..2493342 (-) 1101 WP_025284994.1 glycine cleavage system aminomethyltransferase GcvT -
  MKW31_RS11815 (MKW31_11795) - 2493766..2495436 (+) 1671 WP_007408331.1 SNF2-related protein -
  MKW31_RS11820 (MKW31_11800) - 2495458..2496252 (+) 795 WP_007408330.1 YqhG family protein -
  MKW31_RS11825 (MKW31_11805) sinI 2496429..2496602 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  MKW31_RS11830 (MKW31_11810) sinR 2496636..2496971 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  MKW31_RS11835 (MKW31_11815) - 2497019..2497804 (-) 786 WP_007408329.1 TasA family protein -
  MKW31_RS11840 (MKW31_11820) - 2497869..2498453 (-) 585 WP_015240205.1 signal peptidase I -
  MKW31_RS11845 (MKW31_11825) tapA 2498425..2499096 (-) 672 WP_015417813.1 amyloid fiber anchoring/assembly protein TapA -
  MKW31_RS11850 (MKW31_11830) - 2499355..2499684 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  MKW31_RS11855 (MKW31_11835) - 2499724..2499903 (-) 180 WP_003153093.1 YqzE family protein -
  MKW31_RS11860 (MKW31_11840) comGG 2499960..2500337 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  MKW31_RS11865 (MKW31_11845) comGF 2500338..2500838 (-) 501 WP_254922226.1 competence type IV pilus minor pilin ComGF -
  MKW31_RS11870 (MKW31_11850) comGE 2500747..2501061 (-) 315 WP_094032244.1 competence type IV pilus minor pilin ComGE -
  MKW31_RS11875 (MKW31_11855) comGD 2501045..2501482 (-) 438 WP_094032243.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=659843 MKW31_RS11825 WP_003153105.1 2496429..2496602(+) (sinI) [Bacillus velezensis strain 37-1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=659843 MKW31_RS11825 WP_003153105.1 2496429..2496602(+) (sinI) [Bacillus velezensis strain 37-1]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702