Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | MKW31_RS11825 | Genome accession | NZ_CP092715 |
| Coordinates | 2496429..2496602 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain 37-1 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2491429..2501602
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MKW31_RS11810 (MKW31_11790) | gcvT | 2492242..2493342 (-) | 1101 | WP_025284994.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| MKW31_RS11815 (MKW31_11795) | - | 2493766..2495436 (+) | 1671 | WP_007408331.1 | SNF2-related protein | - |
| MKW31_RS11820 (MKW31_11800) | - | 2495458..2496252 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| MKW31_RS11825 (MKW31_11805) | sinI | 2496429..2496602 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| MKW31_RS11830 (MKW31_11810) | sinR | 2496636..2496971 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| MKW31_RS11835 (MKW31_11815) | - | 2497019..2497804 (-) | 786 | WP_007408329.1 | TasA family protein | - |
| MKW31_RS11840 (MKW31_11820) | - | 2497869..2498453 (-) | 585 | WP_015240205.1 | signal peptidase I | - |
| MKW31_RS11845 (MKW31_11825) | tapA | 2498425..2499096 (-) | 672 | WP_015417813.1 | amyloid fiber anchoring/assembly protein TapA | - |
| MKW31_RS11850 (MKW31_11830) | - | 2499355..2499684 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| MKW31_RS11855 (MKW31_11835) | - | 2499724..2499903 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| MKW31_RS11860 (MKW31_11840) | comGG | 2499960..2500337 (-) | 378 | WP_015417814.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| MKW31_RS11865 (MKW31_11845) | comGF | 2500338..2500838 (-) | 501 | WP_254922226.1 | competence type IV pilus minor pilin ComGF | - |
| MKW31_RS11870 (MKW31_11850) | comGE | 2500747..2501061 (-) | 315 | WP_094032244.1 | competence type IV pilus minor pilin ComGE | - |
| MKW31_RS11875 (MKW31_11855) | comGD | 2501045..2501482 (-) | 438 | WP_094032243.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=659843 MKW31_RS11825 WP_003153105.1 2496429..2496602(+) (sinI) [Bacillus velezensis strain 37-1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=659843 MKW31_RS11825 WP_003153105.1 2496429..2496602(+) (sinI) [Bacillus velezensis strain 37-1]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |