Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   MJ920_RS15030 Genome accession   NZ_CP092499
Coordinates   3049908..3050048 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain YC_89     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3044908..3055048
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MJ920_RS15005 (MJ920_14980) - 3045205..3045588 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  MJ920_RS15010 (MJ920_14985) comA 3045610..3046254 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  MJ920_RS15015 (MJ920_14990) comP 3046335..3048638 (-) 2304 WP_278269285.1 histidine kinase Regulator
  MJ920_RS15020 (MJ920_14995) comX 3048658..3048837 (-) 180 WP_318010531.1 competence pheromone ComX -
  MJ920_RS15025 (MJ920_15000) comQ 3048791..3049777 (-) 987 WP_269321599.1 class 1 isoprenoid biosynthesis enzyme Regulator
  MJ920_RS15030 (MJ920_15005) degQ 3049908..3050048 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  MJ920_RS15035 (MJ920_15010) - 3050513..3050854 (+) 342 WP_173612844.1 hypothetical protein -
  MJ920_RS15040 (MJ920_15015) - 3050861..3052081 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  MJ920_RS15045 (MJ920_15020) - 3052211..3053677 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  MJ920_RS15050 (MJ920_15025) - 3053695..3054246 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  MJ920_RS15055 (MJ920_15030) - 3054343..3054741 (-) 399 WP_278269288.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=658206 MJ920_RS15030 WP_003152043.1 3049908..3050048(-) (degQ) [Bacillus velezensis strain YC_89]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=658206 MJ920_RS15030 WP_003152043.1 3049908..3050048(-) (degQ) [Bacillus velezensis strain YC_89]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891