Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | MJE83_RS13540 | Genome accession | NZ_CP092446 |
| Coordinates | 2708434..2708607 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain R-71003 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2703434..2713607
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MJE83_RS13525 (MJE83_13525) | gcvT | 2704247..2705347 (-) | 1101 | WP_025284994.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| MJE83_RS13530 (MJE83_13530) | - | 2705771..2707441 (+) | 1671 | WP_132105375.1 | SNF2-related protein | - |
| MJE83_RS13535 (MJE83_13535) | - | 2707463..2708257 (+) | 795 | WP_208480294.1 | YqhG family protein | - |
| MJE83_RS13540 (MJE83_13540) | sinI | 2708434..2708607 (+) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| MJE83_RS13545 (MJE83_13545) | sinR | 2708641..2708976 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| MJE83_RS13550 (MJE83_13550) | - | 2709024..2709809 (-) | 786 | WP_007408329.1 | TasA family protein | - |
| MJE83_RS13555 (MJE83_13555) | - | 2709874..2710458 (-) | 585 | WP_015240205.1 | signal peptidase I | - |
| MJE83_RS13560 (MJE83_13560) | tapA | 2710430..2711101 (-) | 672 | WP_124692843.1 | amyloid fiber anchoring/assembly protein TapA | - |
| MJE83_RS13565 (MJE83_13565) | - | 2711360..2711689 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| MJE83_RS13570 (MJE83_13570) | - | 2711729..2711908 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| MJE83_RS13575 (MJE83_13575) | comGG | 2711965..2712342 (-) | 378 | WP_015240208.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| MJE83_RS13580 (MJE83_13580) | comGF | 2712343..2712843 (-) | 501 | WP_256994853.1 | competence type IV pilus minor pilin ComGF | - |
| MJE83_RS13585 (MJE83_13585) | comGE | 2712752..2713066 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| MJE83_RS13590 (MJE83_13590) | comGD | 2713050..2713487 (-) | 438 | WP_015240210.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=657579 MJE83_RS13540 WP_003153105.1 2708434..2708607(+) (sinI) [Bacillus velezensis strain R-71003]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=657579 MJE83_RS13540 WP_003153105.1 2708434..2708607(+) (sinI) [Bacillus velezensis strain R-71003]
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |