Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | MH925_RS11715 | Genome accession | NZ_CP092412 |
| Coordinates | 2429086..2429259 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain HNU24 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2424086..2434259
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MH925_RS11700 | gcvT | 2424899..2425999 (-) | 1101 | WP_012117974.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| MH925_RS11705 | - | 2426423..2428093 (+) | 1671 | WP_012117975.1 | DEAD/DEAH box helicase | - |
| MH925_RS11710 | - | 2428115..2428909 (+) | 795 | WP_012117976.1 | YqhG family protein | - |
| MH925_RS11715 | sinI | 2429086..2429259 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| MH925_RS11720 | sinR | 2429293..2429628 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| MH925_RS11725 | tasA | 2429676..2430461 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| MH925_RS11730 | sipW | 2430526..2431110 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| MH925_RS11735 | tapA | 2431082..2431753 (-) | 672 | WP_012117978.1 | amyloid fiber anchoring/assembly protein TapA | - |
| MH925_RS11740 | - | 2432012..2432341 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| MH925_RS11745 | - | 2432381..2432560 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| MH925_RS11750 | comGG | 2432617..2432994 (-) | 378 | WP_012117980.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| MH925_RS11755 | comGF | 2432995..2433495 (-) | 501 | WP_012117981.1 | competence type IV pilus minor pilin ComGF | - |
| MH925_RS11760 | comGE | 2433404..2433718 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| MH925_RS11765 | comGD | 2433702..2434139 (-) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=657238 MH925_RS11715 WP_003153105.1 2429086..2429259(+) (sinI) [Bacillus velezensis strain HNU24]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=657238 MH925_RS11715 WP_003153105.1 2429086..2429259(+) (sinI) [Bacillus velezensis strain HNU24]
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |