Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   MH925_RS11715 Genome accession   NZ_CP092412
Coordinates   2429086..2429259 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain HNU24     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2424086..2434259
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MH925_RS11700 gcvT 2424899..2425999 (-) 1101 WP_012117974.1 glycine cleavage system aminomethyltransferase GcvT -
  MH925_RS11705 - 2426423..2428093 (+) 1671 WP_012117975.1 DEAD/DEAH box helicase -
  MH925_RS11710 - 2428115..2428909 (+) 795 WP_012117976.1 YqhG family protein -
  MH925_RS11715 sinI 2429086..2429259 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  MH925_RS11720 sinR 2429293..2429628 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  MH925_RS11725 tasA 2429676..2430461 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  MH925_RS11730 sipW 2430526..2431110 (-) 585 WP_012117977.1 signal peptidase I SipW -
  MH925_RS11735 tapA 2431082..2431753 (-) 672 WP_012117978.1 amyloid fiber anchoring/assembly protein TapA -
  MH925_RS11740 - 2432012..2432341 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  MH925_RS11745 - 2432381..2432560 (-) 180 WP_003153093.1 YqzE family protein -
  MH925_RS11750 comGG 2432617..2432994 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  MH925_RS11755 comGF 2432995..2433495 (-) 501 WP_012117981.1 competence type IV pilus minor pilin ComGF -
  MH925_RS11760 comGE 2433404..2433718 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  MH925_RS11765 comGD 2433702..2434139 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=657238 MH925_RS11715 WP_003153105.1 2429086..2429259(+) (sinI) [Bacillus velezensis strain HNU24]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=657238 MH925_RS11715 WP_003153105.1 2429086..2429259(+) (sinI) [Bacillus velezensis strain HNU24]
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702