Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   MH925_RS11750 Genome accession   NZ_CP092412
Coordinates   2432617..2432994 (-) Length   125 a.a.
NCBI ID   WP_012117980.1    Uniprot ID   -
Organism   Bacillus velezensis strain HNU24     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2427617..2437994
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MH925_RS11710 - 2428115..2428909 (+) 795 WP_012117976.1 YqhG family protein -
  MH925_RS11715 sinI 2429086..2429259 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  MH925_RS11720 sinR 2429293..2429628 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  MH925_RS11725 tasA 2429676..2430461 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  MH925_RS11730 sipW 2430526..2431110 (-) 585 WP_012117977.1 signal peptidase I SipW -
  MH925_RS11735 tapA 2431082..2431753 (-) 672 WP_012117978.1 amyloid fiber anchoring/assembly protein TapA -
  MH925_RS11740 - 2432012..2432341 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  MH925_RS11745 - 2432381..2432560 (-) 180 WP_003153093.1 YqzE family protein -
  MH925_RS11750 comGG 2432617..2432994 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  MH925_RS11755 comGF 2432995..2433495 (-) 501 WP_012117981.1 competence type IV pilus minor pilin ComGF -
  MH925_RS11760 comGE 2433404..2433718 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  MH925_RS11765 comGD 2433702..2434139 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  MH925_RS11770 comGC 2434129..2434395 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  MH925_RS11775 comGB 2434442..2435479 (-) 1038 WP_012117984.1 competence type IV pilus assembly protein ComGB Machinery gene
  MH925_RS11780 comGA 2435466..2436536 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  MH925_RS11785 - 2436733..2437683 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14195.14 Da        Isoelectric Point: 9.7165

>NTDB_id=657240 MH925_RS11750 WP_012117980.1 2432617..2432994(-) (comGG) [Bacillus velezensis strain HNU24]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGVLLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=657240 MH925_RS11750 WP_012117980.1 2432617..2432994(-) (comGG) [Bacillus velezensis strain HNU24]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
GTCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
TGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512