Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   MH925_RS02055 Genome accession   NZ_CP092412
Coordinates   402284..402403 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain HNU24     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 397284..407403
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MH925_RS02040 - 398896..399579 (+) 684 WP_007410267.1 response regulator transcription factor -
  MH925_RS02045 - 399566..400999 (+) 1434 WP_162303988.1 sensor histidine kinase -
  MH925_RS02050 rapC 401152..402300 (+) 1149 WP_012116798.1 Rap family tetratricopeptide repeat protein Regulator
  MH925_RS02055 phrC 402284..402403 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  MH925_RS02060 - 402552..402662 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  MH925_RS02065 - 402742..404106 (-) 1365 WP_012116801.1 aspartate kinase -
  MH925_RS02070 ceuB 404520..405473 (+) 954 WP_012116802.1 ABC transporter permease Machinery gene
  MH925_RS02075 - 405463..406410 (+) 948 WP_012116803.1 iron chelate uptake ABC transporter family permease subunit -
  MH925_RS02080 - 406404..407162 (+) 759 WP_012116804.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=657209 MH925_RS02055 WP_003156334.1 402284..402403(+) (phrC) [Bacillus velezensis strain HNU24]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=657209 MH925_RS02055 WP_003156334.1 402284..402403(+) (phrC) [Bacillus velezensis strain HNU24]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718