Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MF598_RS04550 Genome accession   NZ_CP092185
Coordinates   893607..893747 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain K203     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 888607..898747
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MF598_RS04525 (MF598_04525) - 888910..889308 (+) 399 WP_042635454.1 DUF1694 domain-containing protein -
  MF598_RS04530 (MF598_04530) - 889405..889956 (+) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  MF598_RS04535 (MF598_04535) - 889974..891440 (+) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  MF598_RS04540 (MF598_04540) - 891570..892793 (+) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  MF598_RS04545 (MF598_04545) - 892800..893141 (-) 342 WP_025285192.1 hypothetical protein -
  MF598_RS04550 (MF598_04550) degQ 893607..893747 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  MF598_RS04555 (MF598_04555) - 893878..894807 (+) 930 WP_224223773.1 polyprenyl synthetase family protein -
  MF598_RS04560 (MF598_04560) comX 894804..894974 (+) 171 WP_045208751.1 competence pheromone ComX -
  MF598_RS04565 (MF598_04565) comP 894952..897303 (+) 2352 WP_275424139.1 histidine kinase Regulator
  MF598_RS04570 (MF598_04570) comA 897384..898028 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  MF598_RS04575 (MF598_04575) - 898050..898433 (+) 384 WP_007613430.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=656233 MF598_RS04550 WP_003152043.1 893607..893747(+) (degQ) [Bacillus velezensis strain K203]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=656233 MF598_RS04550 WP_003152043.1 893607..893747(+) (degQ) [Bacillus velezensis strain K203]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891