Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   LGL65_RS18845 Genome accession   NZ_CP092110
Coordinates   3645561..3645734 (-) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain LOH112     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 3640561..3650734
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LGL65_RS18795 comGD 3640680..3641117 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  LGL65_RS18800 comGE 3641101..3641415 (+) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  LGL65_RS18805 comGF 3641429..3641824 (+) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  LGL65_RS18810 comGG 3641825..3642202 (+) 378 WP_025649851.1 competence type IV pilus minor pilin ComGG Machinery gene
  LGL65_RS18815 - 3642259..3642438 (+) 180 WP_003153093.1 YqzE family protein -
  LGL65_RS18820 - 3642479..3642808 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  LGL65_RS18825 tapA 3643067..3643738 (+) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  LGL65_RS18830 - 3643710..3644294 (+) 585 WP_012117977.1 signal peptidase I -
  LGL65_RS18835 - 3644359..3645144 (+) 786 WP_017418136.1 TasA family protein -
  LGL65_RS18840 sinR 3645192..3645527 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LGL65_RS18845 sinI 3645561..3645734 (-) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  LGL65_RS18850 - 3645911..3646705 (-) 795 WP_014305407.1 YqhG family protein -
  LGL65_RS18855 - 3646727..3648397 (-) 1671 WP_017418135.1 SNF2-related protein -
  LGL65_RS18860 gcvT 3648821..3649921 (+) 1101 WP_017418134.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=655997 LGL65_RS18845 WP_014418369.1 3645561..3645734(-) (sinI) [Bacillus velezensis strain LOH112]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=655997 LGL65_RS18845 WP_014418369.1 3645561..3645734(-) (sinI) [Bacillus velezensis strain LOH112]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719