Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MAK48_RS16365 Genome accession   NZ_CP091872
Coordinates   3149607..3149747 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus sp. Man122     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3144607..3154747
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MAK48_RS16340 (MAK48_16340) - 3144957..3145337 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  MAK48_RS16345 (MAK48_16345) comA 3145356..3146000 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  MAK48_RS16350 (MAK48_16350) comP 3146081..3148378 (-) 2298 WP_032730345.1 histidine kinase Regulator
  MAK48_RS16355 (MAK48_16355) comX 3148386..3148547 (-) 162 WP_003228803.1 competence pheromone ComX -
  MAK48_RS16360 (MAK48_16360) - 3148562..3149422 (-) 861 WP_029318489.1 polyprenyl synthetase family protein -
  MAK48_RS16365 (MAK48_16365) degQ 3149607..3149747 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  MAK48_RS16370 (MAK48_16370) - 3149969..3150094 (+) 126 WP_003228793.1 hypothetical protein -
  MAK48_RS16375 (MAK48_16375) - 3150208..3150576 (+) 369 WP_014477834.1 hypothetical protein -
  MAK48_RS16380 (MAK48_16380) pdeH 3150552..3151781 (-) 1230 WP_003228790.1 cyclic di-GMP phosphodiesterase -
  MAK48_RS16385 (MAK48_16385) - 3151918..3153390 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  MAK48_RS16390 (MAK48_16390) - 3153406..3153957 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  MAK48_RS16395 (MAK48_16395) - 3154054..3154452 (-) 399 WP_019712929.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=654055 MAK48_RS16365 WP_003220708.1 3149607..3149747(-) (degQ) [Bacillus sp. Man122]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=654055 MAK48_RS16365 WP_003220708.1 3149607..3149747(-) (degQ) [Bacillus sp. Man122]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1