Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   BEST7003_RS15465 Genome accession   NZ_AP012496
Coordinates   3088150..3088317 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis BEST7003     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3083150..3093317
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BEST7003_RS15435 (BEST7003_3046) mrpE 3083545..3084021 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  BEST7003_RS15440 (BEST7003_3047) mrpF 3084021..3084305 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  BEST7003_RS15445 (BEST7003_3048) mnhG 3084289..3084663 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  BEST7003_RS15450 (BEST7003_3049) yuxO 3084702..3085082 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  BEST7003_RS15455 (BEST7003_3050) comA 3085101..3085745 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  BEST7003_RS15460 comP 3085826..3088135 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  BEST7003_RS15465 (BEST7003_3053) comX 3088150..3088317 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  BEST7003_RS15470 (BEST7003_3054) comQ 3088305..3089204 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  BEST7003_RS15475 (BEST7003_3055) degQ 3089389..3089529 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  BEST7003_RS21935 - 3089751..3089876 (+) 126 WP_003228793.1 hypothetical protein -
  BEST7003_RS15480 (BEST7003_3056) - 3089990..3090358 (+) 369 WP_003243784.1 hypothetical protein -
  BEST7003_RS15485 (BEST7003_3057) pdeH 3090334..3091563 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  BEST7003_RS15490 (BEST7003_3058) pncB 3091700..3093172 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=65271 BEST7003_RS15465 WP_003242801.1 3088150..3088317(-) (comX) [Bacillus subtilis BEST7003]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=65271 BEST7003_RS15465 WP_003242801.1 3088150..3088317(-) (comX) [Bacillus subtilis BEST7003]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment