Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   BEST7003_RS11780 Genome accession   NZ_AP012496
Coordinates   2384241..2384414 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis BEST7003     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2379241..2389414
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BEST7003_RS11765 (BEST7003_2315) gcvT 2380040..2381128 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  BEST7003_RS11770 (BEST7003_2316) hepAA 2381570..2383243 (+) 1674 WP_004398544.1 SNF2-related protein -
  BEST7003_RS11775 (BEST7003_2317) yqhG 2383264..2384058 (+) 795 WP_003230200.1 YqhG family protein -
  BEST7003_RS11780 (BEST7003_2318) sinI 2384241..2384414 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  BEST7003_RS11785 (BEST7003_2319) sinR 2384448..2384783 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  BEST7003_RS11790 (BEST7003_2320) tasA 2384876..2385661 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  BEST7003_RS11795 (BEST7003_2321) sipW 2385725..2386297 (-) 573 WP_003246088.1 signal peptidase I SipW -
  BEST7003_RS11800 (BEST7003_2322) tapA 2386281..2387042 (-) 762 Protein_2360 amyloid fiber anchoring/assembly protein TapA -
  BEST7003_RS11805 (BEST7003_2324) yqzG 2387314..2387640 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  BEST7003_RS11810 (BEST7003_2325) spoIITA 2387682..2387861 (-) 180 WP_003230176.1 YqzE family protein -
  BEST7003_RS11815 (BEST7003_2326) comGG 2387932..2388306 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  BEST7003_RS11820 (BEST7003_2327) comGF 2388307..2388690 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  BEST7003_RS11825 (BEST7003_2328) comGE 2388716..2389063 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=65247 BEST7003_RS11780 WP_003230187.1 2384241..2384414(+) (sinI) [Bacillus subtilis BEST7003]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=65247 BEST7003_RS11780 WP_003230187.1 2384241..2384414(+) (sinI) [Bacillus subtilis BEST7003]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment