Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   L1999_RS20230 Genome accession   NZ_CP091110
Coordinates   4299803..4300204 (-) Length   133 a.a.
NCBI ID   WP_235740212.1    Uniprot ID   -
Organism   Neobacillus drentensis strain JC05     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 4273080..4313294 4299803..4300204 within 0


Gene organization within MGE regions


Location: 4273080..4313294
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  L1999_RS20085 (L1999_20085) - 4273455..4274048 (-) 594 WP_235740181.1 replication-relaxation family protein -
  L1999_RS20090 (L1999_20090) - 4273984..4275255 (-) 1272 WP_235740182.1 FtsK/SpoIIIE domain-containing protein -
  L1999_RS20095 (L1999_20095) - 4275552..4275788 (+) 237 WP_235740184.1 hypothetical protein -
  L1999_RS20100 (L1999_20100) - 4275793..4276119 (+) 327 WP_235740186.1 hypothetical protein -
  L1999_RS29685 - 4276135..4276752 (-) 618 WP_275677139.1 glycoside hydrolase family protein -
  L1999_RS20115 (L1999_20115) - 4276749..4277147 (-) 399 WP_235740188.1 phage holin family protein -
  L1999_RS20120 (L1999_20120) - 4277183..4277362 (-) 180 WP_235740189.1 hypothetical protein -
  L1999_RS20125 (L1999_20125) - 4277367..4281617 (-) 4251 WP_235740191.1 LPD38 domain-containing protein -
  L1999_RS20130 (L1999_20130) - 4281653..4282360 (-) 708 WP_235740192.1 HNH endonuclease -
  L1999_RS20135 (L1999_20135) - 4282418..4283680 (-) 1263 WP_235740193.1 hypothetical protein -
  L1999_RS20140 (L1999_20140) - 4283705..4284334 (-) 630 WP_235740194.1 hypothetical protein -
  L1999_RS20145 (L1999_20145) - 4284348..4286228 (-) 1881 WP_235740195.1 DUF2460 domain-containing protein -
  L1999_RS20150 (L1999_20150) - 4286268..4287662 (-) 1395 WP_235740196.1 hypothetical protein -
  L1999_RS20155 (L1999_20155) - 4287662..4288105 (-) 444 WP_235740197.1 hypothetical protein -
  L1999_RS20160 (L1999_20160) - 4288146..4289825 (-) 1680 WP_235740198.1 SGNH/GDSL hydrolase family protein -
  L1999_RS29690 - 4289887..4290021 (-) 135 WP_275677141.1 hypothetical protein -
  L1999_RS20165 (L1999_20165) - 4290036..4290863 (-) 828 WP_235740199.1 N4-gp56 family major capsid protein -
  L1999_RS20170 (L1999_20170) - 4290883..4291674 (-) 792 WP_235740200.1 hypothetical protein -
  L1999_RS20175 (L1999_20175) - 4291747..4293375 (-) 1629 WP_235740201.1 hypothetical protein -
  L1999_RS20180 (L1999_20180) - 4293557..4294222 (-) 666 WP_235740202.1 AP2 domain-containing protein -
  L1999_RS20185 (L1999_20185) - 4294419..4294628 (-) 210 WP_235740203.1 hypothetical protein -
  L1999_RS20190 (L1999_20190) terL 4294633..4296126 (-) 1494 WP_235740204.1 phage terminase large subunit -
  L1999_RS20195 (L1999_20195) - 4296098..4296688 (-) 591 WP_235740205.1 terminase small subunit -
  L1999_RS20200 (L1999_20200) - 4297440..4297841 (-) 402 WP_235740206.1 DNA-binding response regulator -
  L1999_RS20205 (L1999_20205) - 4297846..4298001 (-) 156 WP_235740207.1 hypothetical protein -
  L1999_RS20210 (L1999_20210) - 4297998..4298408 (-) 411 WP_235740208.1 hypothetical protein -
  L1999_RS20215 (L1999_20215) - 4298511..4298849 (-) 339 WP_235740209.1 DUF1523 family protein -
  L1999_RS20220 (L1999_20220) - 4298846..4299136 (-) 291 WP_235740210.1 hypothetical protein -
  L1999_RS29695 - 4299126..4299251 (-) 126 WP_275677145.1 hypothetical protein -
  L1999_RS20225 (L1999_20225) - 4299238..4299567 (-) 330 WP_235740211.1 nucleoside triphosphate pyrophosphohydrolase family protein -
  L1999_RS20230 (L1999_20230) ssb 4299803..4300204 (-) 402 WP_235740212.1 single-stranded DNA-binding protein Machinery gene
  L1999_RS20235 (L1999_20235) - 4300221..4301075 (-) 855 WP_235740213.1 hypothetical protein -
  L1999_RS20240 (L1999_20240) - 4301128..4301598 (-) 471 WP_235740214.1 HNH endonuclease signature motif containing protein -
  L1999_RS20245 (L1999_20245) - 4301589..4301804 (-) 216 WP_235740215.1 hypothetical protein -
  L1999_RS20250 (L1999_20250) - 4301804..4301950 (-) 147 WP_235740216.1 hypothetical protein -
  L1999_RS20255 (L1999_20255) - 4301943..4302197 (-) 255 WP_235740217.1 DUF3310 domain-containing protein -
  L1999_RS20260 (L1999_20260) - 4302197..4302373 (-) 177 WP_235740218.1 hypothetical protein -
  L1999_RS20265 (L1999_20265) - 4302367..4302657 (-) 291 WP_235740219.1 hypothetical protein -
  L1999_RS20270 (L1999_20270) - 4302842..4303039 (-) 198 WP_235740220.1 hypothetical protein -
  L1999_RS20275 (L1999_20275) - 4303345..4304214 (-) 870 WP_235740221.1 ATP-binding protein -
  L1999_RS20280 (L1999_20280) - 4304190..4304972 (-) 783 WP_235740222.1 DUF4373 domain-containing protein -
  L1999_RS20285 (L1999_20285) - 4304974..4305237 (-) 264 WP_235740223.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
  L1999_RS20290 (L1999_20290) - 4305336..4305542 (-) 207 WP_235740224.1 helix-turn-helix transcriptional regulator -
  L1999_RS20295 (L1999_20295) - 4305738..4305950 (+) 213 WP_235740225.1 helix-turn-helix transcriptional regulator -
  L1999_RS20300 (L1999_20300) - 4306174..4306647 (-) 474 WP_235740226.1 hypothetical protein -
  L1999_RS20305 (L1999_20305) - 4306667..4306885 (-) 219 WP_235740227.1 hypothetical protein -
  L1999_RS20310 (L1999_20310) - 4306918..4307076 (-) 159 WP_235740228.1 hypothetical protein -
  L1999_RS20315 (L1999_20315) - 4307077..4307328 (-) 252 WP_235740229.1 hypothetical protein -
  L1999_RS20320 (L1999_20320) - 4307297..4307575 (-) 279 WP_235740230.1 hypothetical protein -
  L1999_RS20325 (L1999_20325) - 4307837..4308490 (-) 654 WP_235740231.1 ERF family protein -
  L1999_RS29700 - 4308483..4308617 (-) 135 WP_275677146.1 hypothetical protein -
  L1999_RS20330 (L1999_20330) - 4308682..4308867 (-) 186 WP_235740232.1 hypothetical protein -
  L1999_RS20335 (L1999_20335) - 4308908..4309057 (-) 150 WP_235740233.1 hypothetical protein -
  L1999_RS20340 (L1999_20340) - 4309088..4309225 (-) 138 WP_235740234.1 hypothetical protein -
  L1999_RS20345 (L1999_20345) - 4309281..4309592 (-) 312 WP_235740235.1 hypothetical protein -
  L1999_RS20350 (L1999_20350) - 4309617..4309805 (-) 189 WP_235740236.1 hypothetical protein -
  L1999_RS20355 (L1999_20355) - 4309912..4310343 (-) 432 WP_235740237.1 HNH endonuclease -
  L1999_RS20360 (L1999_20360) - 4310340..4310531 (-) 192 WP_235740238.1 helix-turn-helix domain-containing protein -
  L1999_RS20365 (L1999_20365) - 4310572..4310760 (-) 189 WP_235740239.1 helix-turn-helix domain-containing protein -
  L1999_RS20370 (L1999_20370) - 4310955..4311293 (+) 339 WP_235740240.1 helix-turn-helix domain-containing protein -
  L1999_RS20375 (L1999_20375) - 4311575..4312720 (+) 1146 WP_235740241.1 site-specific integrase -
  L1999_RS20380 (L1999_20380) - 4312736..4313293 (-) 558 WP_235740242.1 YppG family protein -

Sequence

Protein


Download         Length: 133 a.a.        Molecular weight: 14890.82 Da        Isoelectric Point: 5.9075

>NTDB_id=647789 L1999_RS20230 WP_235740212.1 4299803..4300204(-) (ssb) [Neobacillus drentensis strain JC05]
MNITTLIGRLTKEGDLKYSESGTAIYKNSIAVNRKFKKDEADFINLVAFQKTAELMANHLTKGDQVGIEGRIQIGSYEKD
GKRIYTFDVVVDNITFIGSKKQDKPAPQPQTRVTEDPFNGYGAINIQDDDLPF

Nucleotide


Download         Length: 402 bp        

>NTDB_id=647789 L1999_RS20230 WP_235740212.1 4299803..4300204(-) (ssb) [Neobacillus drentensis strain JC05]
ATGAATATAACAACACTTATCGGACGTTTAACAAAAGAAGGAGATTTAAAATATAGCGAGTCAGGAACAGCCATTTATAA
AAACAGTATTGCGGTTAATCGTAAGTTTAAAAAGGATGAAGCGGATTTTATTAACCTTGTTGCCTTCCAAAAAACAGCCG
AACTGATGGCGAACCACTTAACCAAAGGGGATCAAGTAGGGATTGAGGGCCGTATTCAAATAGGCAGCTATGAAAAAGAC
GGAAAGAGAATCTACACTTTTGATGTAGTAGTAGACAACATTACTTTTATCGGCAGCAAGAAGCAGGATAAGCCAGCACC
ACAGCCACAAACAAGGGTAACAGAAGATCCTTTTAATGGTTATGGAGCGATTAATATTCAGGATGATGATTTACCTTTCT
GA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(1-96)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

39.053

100

0.496
  ssbA Bacillus subtilis subsp. subtilis str. 168

32.749

100

0.421