Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   L1704_RS11280 Genome accession   NZ_CP091107
Coordinates   2169486..2169812 (-) Length   108 a.a.
NCBI ID   WP_058221568.1    Uniprot ID   -
Organism   Lactococcus lactis subsp. lactis strain UC109     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2166168..2213312 2169486..2169812 within 0


Gene organization within MGE regions


Location: 2166168..2213312
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  L1704_RS11260 (L1704_11260) - 2166168..2166905 (-) 738 WP_058221575.1 metal ABC transporter ATP-binding protein -
  L1704_RS11265 (L1704_11265) - 2167082..2167924 (-) 843 WP_003129990.1 metal ABC transporter substrate-binding protein -
  L1704_RS11270 (L1704_11270) - 2167921..2168358 (-) 438 WP_003129992.1 zinc-dependent MarR family transcriptional regulator -
  L1704_RS11275 (L1704_11275) - 2168565..2169512 (+) 948 WP_081196255.1 IS30 family transposase -
  L1704_RS11280 (L1704_11280) comGG 2169486..2169812 (-) 327 WP_058221568.1 competence type IV pilus minor pilin ComGG Machinery gene
  L1704_RS11285 (L1704_11285) comGF 2169851..2170297 (-) 447 WP_058225890.1 competence type IV pilus minor pilin ComGF Machinery gene
  L1704_RS11290 (L1704_11290) comGE 2170260..2170556 (-) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  L1704_RS11295 (L1704_11295) comGD 2170528..2170959 (-) 432 WP_080585155.1 competence type IV pilus minor pilin ComGD Machinery gene
  L1704_RS11300 (L1704_11300) comGC 2170919..2171188 (-) 270 WP_003129998.1 competence type IV pilus major pilin ComGC Machinery gene
  L1704_RS11305 (L1704_11305) - 2171362..2171829 (-) 468 WP_058225891.1 hypothetical protein -
  L1704_RS11310 (L1704_11310) - 2171912..2172085 (-) 174 WP_160321615.1 hypothetical protein -
  L1704_RS11315 (L1704_11315) - 2172172..2172951 (-) 780 WP_058225892.1 peptidoglycan amidohydrolase family protein -
  L1704_RS11320 (L1704_11320) - 2172951..2173238 (-) 288 WP_023164507.1 phage holin -
  L1704_RS11325 (L1704_11325) - 2173251..2173601 (-) 351 WP_058225893.1 hypothetical protein -
  L1704_RS11330 (L1704_11330) - 2173614..2173850 (-) 237 WP_081196280.1 hypothetical protein -
  L1704_RS11335 (L1704_11335) - 2173862..2178577 (-) 4716 WP_237024113.1 hypothetical protein -
  L1704_RS11340 (L1704_11340) - 2178556..2180085 (-) 1530 WP_014570562.1 distal tail protein Dit -
  L1704_RS11345 (L1704_11345) - 2180095..2181156 (-) 1062 WP_235589838.1 hypothetical protein -
  L1704_RS11350 (L1704_11350) - 2181223..2181657 (-) 435 WP_003131321.1 minor capsid protein -
  L1704_RS11355 (L1704_11355) - 2181657..2181986 (-) 330 WP_003131320.1 hypothetical protein -
  L1704_RS11360 (L1704_11360) - 2181983..2182327 (-) 345 WP_014570557.1 putative minor capsid protein -
  L1704_RS11365 (L1704_11365) - 2182317..2182718 (-) 402 WP_014570556.1 hypothetical protein -
  L1704_RS11370 (L1704_11370) - 2182792..2183028 (-) 237 WP_014570555.1 Ig-like domain-containing protein -
  L1704_RS11375 (L1704_11375) - 2183057..2183974 (-) 918 WP_003131315.1 hypothetical protein -
  L1704_RS11380 (L1704_11380) - 2183989..2185053 (-) 1065 WP_058225779.1 XkdF-like putative serine protease domain-containing protein -
  L1704_RS11385 (L1704_11385) - 2185069..2185899 (-) 831 WP_014570553.1 phage minor head protein -
  L1704_RS11390 (L1704_11390) - 2185892..2187421 (-) 1530 WP_058225778.1 phage portal protein -
  L1704_RS11395 (L1704_11395) terL 2187434..2188876 (-) 1443 WP_152023954.1 phage terminase large subunit -
  L1704_RS11400 (L1704_11400) - 2188866..2189087 (-) 222 Protein_2162 helix-turn-helix domain-containing protein -
  L1704_RS13050 - 2189205..2189675 (-) 471 Protein_2163 HNH endonuclease -
  L1704_RS11410 (L1704_11410) - 2189847..2190236 (-) 390 WP_023164630.1 DUF722 domain-containing protein -
  L1704_RS11415 (L1704_11415) - 2190740..2190958 (-) 219 WP_058225572.1 hypothetical protein -
  L1704_RS11420 (L1704_11420) - 2190955..2191137 (-) 183 WP_058225573.1 hypothetical protein -
  L1704_RS11425 (L1704_11425) - 2191318..2191518 (-) 201 WP_058225688.1 DUF1660 domain-containing protein -
  L1704_RS11430 (L1704_11430) - 2191515..2191757 (-) 243 WP_014570545.1 hypothetical protein -
  L1704_RS11435 (L1704_11435) - 2191804..2192496 (-) 693 WP_081196281.1 hypothetical protein -
  L1704_RS11440 (L1704_11440) - 2192523..2192876 (-) 354 WP_081196282.1 hypothetical protein -
  L1704_RS11445 (L1704_11445) - 2192879..2193298 (-) 420 WP_081196283.1 dUTP diphosphatase -
  L1704_RS11450 (L1704_11450) - 2193295..2193606 (-) 312 WP_058225823.1 hypothetical protein -
  L1704_RS11455 (L1704_11455) - 2193603..2194169 (-) 567 WP_058225822.1 DUF1642 domain-containing protein -
  L1704_RS11460 (L1704_11460) - 2194185..2194436 (-) 252 WP_023188825.1 hypothetical protein -
  L1704_RS11465 (L1704_11465) - 2194448..2194723 (-) 276 WP_014570536.1 hypothetical protein -
  L1704_RS11470 (L1704_11470) - 2194732..2194938 (-) 207 WP_014570535.1 hypothetical protein -
  L1704_RS11475 (L1704_11475) - 2195049..2195288 (-) 240 WP_058225578.1 DUF1031 family protein -
  L1704_RS11480 (L1704_11480) - 2195285..2195590 (-) 306 WP_058225577.1 hypothetical protein -
  L1704_RS11485 (L1704_11485) - 2195595..2195984 (-) 390 WP_081196284.1 RusA family crossover junction endodeoxyribonuclease -
  L1704_RS11490 (L1704_11490) - 2195997..2196239 (-) 243 WP_014570811.1 L-rhamnose isomerase -
  L1704_RS11495 (L1704_11495) - 2196232..2197134 (-) 903 WP_058225991.1 phage replisome organizer N-terminal domain-containing protein -
  L1704_RS11505 (L1704_11505) - 2197414..2198340 (-) 927 WP_058225990.1 RecT family recombinase -
  L1704_RS11510 (L1704_11510) - 2198337..2199170 (-) 834 WP_058225989.1 hypothetical protein -
  L1704_RS11515 (L1704_11515) - 2199273..2199515 (-) 243 WP_058225988.1 hypothetical protein -
  L1704_RS13010 - 2199528..2199650 (-) 123 WP_023164646.1 hypothetical protein -
  L1704_RS11520 (L1704_11520) - 2199647..2199829 (-) 183 WP_003130605.1 hypothetical protein -
  L1704_RS11525 (L1704_11525) - 2199845..2200558 (-) 714 WP_081042558.1 ORF6C domain-containing protein -
  L1704_RS11530 (L1704_11530) - 2200614..2200823 (-) 210 WP_023164648.1 helix-turn-helix transcriptional regulator -
  L1704_RS11535 (L1704_11535) - 2201016..2201441 (+) 426 WP_201013557.1 XRE family transcriptional regulator -
  L1704_RS11540 (L1704_11540) - 2201452..2202036 (+) 585 WP_058225987.1 hypothetical protein -
  L1704_RS11545 (L1704_11545) - 2202095..2202388 (+) 294 WP_058225986.1 hypothetical protein -
  L1704_RS11550 (L1704_11550) - 2202533..2203990 (+) 1458 WP_058225993.1 recombinase family protein -
  L1704_RS11555 (L1704_11555) - 2203987..2204127 (-) 141 WP_023164653.1 hypothetical protein -
  L1704_RS11560 (L1704_11560) comGB 2204141..2204719 (-) 579 WP_235589859.1 type II secretion system F family protein Machinery gene
  L1704_RS11565 (L1704_11565) istB 2204802..2205560 (-) 759 WP_003331414.1 IS21-like element IS712 family helper ATPase IstB -
  L1704_RS11570 (L1704_11570) istA 2205572..2206795 (-) 1224 WP_003331415.1 IS21-like element IS712 family transposase -
  L1704_RS11575 (L1704_11575) comGB 2206871..2207329 (-) 459 WP_327063280.1 type II secretion system F family protein Machinery gene
  L1704_RS11580 (L1704_11580) comGA 2207277..2208216 (-) 940 Protein_2198 competence type IV pilus ATPase ComGA -
  L1704_RS11585 (L1704_11585) - 2208336..2213252 (-) 4917 WP_058221721.1 PolC-type DNA polymerase III -

Sequence

Protein


Download         Length: 108 a.a.        Molecular weight: 12234.69 Da        Isoelectric Point: 6.0669

>NTDB_id=647745 L1704_RS11280 WP_058221568.1 2169486..2169812(-) (comGG) [Lactococcus lactis subsp. lactis strain UC109]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDENTYQF
SIHLKDGANFQIKNANCKSKLASQAHLI

Nucleotide


Download         Length: 327 bp        

>NTDB_id=647745 L1704_RS11280 WP_058221568.1 2169486..2169812(-) (comGG) [Lactococcus lactis subsp. lactis strain UC109]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAATACCTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAACGCAAATTGCAAGTCCAAGTTAGCCAGCCAAGCTCATCT
CATATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

58.065

86.111

0.5