Detailed information    

insolico Bioinformatically predicted

Overview


Name   dprA   Type   Machinery gene
Locus tag   KB233_RS07270 Genome accession   NZ_CP090998
Coordinates   1561692..1562564 (-) Length   290 a.a.
NCBI ID   WP_002484839.1    Uniprot ID   A0A4Y7VXK4
Organism   Staphylococcus epidermidis strain BC1191     
Function   ssDNA binding; loading RecA onto ssDNA (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1523232..1594357 1561692..1562564 within 0


Gene organization within MGE regions


Location: 1523232..1594357
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KB233_RS07125 (KB233_07125) yfmF 1524272..1525543 (-) 1272 WP_002439538.1 EF-P 5-aminopentanol modification-associated protein YfmF -
  KB233_RS07130 (KB233_07130) - 1525574..1526287 (-) 714 WP_002439536.1 GntR family transcriptional regulator -
  KB233_RS07135 (KB233_07135) - 1526290..1528683 (-) 2394 WP_002439534.1 DNA translocase FtsK -
  KB233_RS07140 (KB233_07140) rnjB 1528949..1530622 (-) 1674 WP_002457357.1 ribonuclease J2 -
  KB233_RS07145 (KB233_07145) pnp 1530990..1533095 (-) 2106 WP_001832554.1 polyribonucleotide nucleotidyltransferase -
  KB233_RS07150 (KB233_07150) rpsO 1533227..1533496 (-) 270 WP_002439528.1 30S ribosomal protein S15 -
  KB233_RS07155 (KB233_07155) - 1533616..1534587 (-) 972 WP_235083082.1 bifunctional riboflavin kinase/FAD synthetase -
  KB233_RS07160 (KB233_07160) truB 1534603..1535520 (-) 918 WP_002456563.1 tRNA pseudouridine(55) synthase TruB -
  KB233_RS07165 (KB233_07165) rbfA 1535658..1536008 (-) 351 WP_001829509.1 30S ribosome-binding factor RbfA -
  KB233_RS07170 (KB233_07170) infB 1536311..1538473 (-) 2163 WP_002468903.1 translation initiation factor IF-2 -
  KB233_RS07175 (KB233_07175) - 1538478..1538795 (-) 318 WP_002439520.1 YlxQ family RNA-binding protein -
  KB233_RS07180 (KB233_07180) rnpM 1538795..1539079 (-) 285 WP_001829465.1 RNase P modulator RnpM -
  KB233_RS07185 (KB233_07185) nusA 1539097..1540320 (-) 1224 WP_002456565.1 transcription termination factor NusA -
  KB233_RS07190 (KB233_07190) rimP 1540341..1540808 (-) 468 WP_002439519.1 ribosome maturation factor RimP -
  KB233_RS07195 (KB233_07195) - 1540987..1545297 (-) 4311 WP_002456566.1 PolC-type DNA polymerase III -
  KB233_RS07200 (KB233_07200) - 1545547..1547250 (-) 1704 WP_001829513.1 proline--tRNA ligase -
  KB233_RS07205 (KB233_07205) rseP 1547269..1548555 (-) 1287 WP_001829501.1 RIP metalloprotease RseP -
  KB233_RS07210 (KB233_07210) - 1548789..1549571 (-) 783 WP_001829499.1 phosphatidate cytidylyltransferase -
  KB233_RS07215 (KB233_07215) - 1549575..1550345 (-) 771 WP_001832561.1 isoprenyl transferase -
  KB233_RS07220 (KB233_07220) frr 1550566..1551120 (-) 555 WP_001829472.1 ribosome recycling factor -
  KB233_RS07225 (KB233_07225) pyrH 1551137..1551859 (-) 723 WP_002439511.1 UMP kinase -
  KB233_RS07230 (KB233_07230) tsf 1552000..1552878 (-) 879 WP_002439509.1 translation elongation factor Ts -
  KB233_RS07235 (KB233_07235) rpsB 1553030..1553818 (-) 789 WP_001832557.1 30S ribosomal protein S2 -
  KB233_RS07240 (KB233_07240) codY 1554181..1554951 (-) 771 WP_002439506.1 GTP-sensing pleiotropic transcriptional regulator CodY -
  KB233_RS07245 (KB233_07245) hslU 1554975..1556378 (-) 1404 WP_001829474.1 ATP-dependent protease ATPase subunit HslU -
  KB233_RS07250 (KB233_07250) hslV 1556447..1556989 (-) 543 WP_001829498.1 ATP-dependent protease subunit HslV -
  KB233_RS07255 (KB233_07255) xerC 1556993..1557853 (-) 861 WP_002439503.1 tyrosine recombinase XerC -
  KB233_RS07260 (KB233_07260) trmFO 1558108..1559415 (-) 1308 WP_001832560.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  KB233_RS07265 (KB233_07265) topA 1559440..1561509 (-) 2070 WP_001829508.1 type I DNA topoisomerase -
  KB233_RS07270 (KB233_07270) dprA 1561692..1562564 (-) 873 WP_002484839.1 DNA-processing protein DprA Machinery gene
  KB233_RS07280 (KB233_07280) sucD 1563370..1564278 (-) 909 WP_002446283.1 succinate--CoA ligase subunit alpha -
  KB233_RS07285 (KB233_07285) sucC 1564300..1565466 (-) 1167 WP_002439496.1 ADP-forming succinate--CoA ligase subunit beta -
  KB233_RS07290 (KB233_07290) - 1565574..1566344 (-) 771 WP_001829514.1 ribonuclease HII -
  KB233_RS07295 (KB233_07295) ylqF 1566349..1567212 (-) 864 WP_002468554.1 ribosome biogenesis GTPase YlqF -
  KB233_RS07300 (KB233_07300) - 1567541..1570141 (+) 2601 WP_049324014.1 YfhO family protein -
  KB233_RS07305 (KB233_07305) - 1570134..1572737 (+) 2604 WP_049324013.1 YfhO family protein -
  KB233_RS07310 (KB233_07310) rplS 1573268..1573618 (-) 351 WP_002436293.1 50S ribosomal protein L19 -
  KB233_RS07315 (KB233_07315) trmD 1573724..1574461 (-) 738 WP_001829466.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  KB233_RS07320 (KB233_07320) rimM 1574461..1574964 (-) 504 WP_001832559.1 ribosome maturation factor RimM -
  KB233_RS07325 (KB233_07325) rpsP 1575091..1575366 (-) 276 WP_002439483.1 30S ribosomal protein S16 -
  KB233_RS07330 (KB233_07330) ffh 1575922..1577289 (-) 1368 WP_001830113.1 signal recognition particle protein -
  KB233_RS07335 (KB233_07335) - 1577320..1577652 (-) 333 WP_002457379.1 putative DNA-binding protein -
  KB233_RS07340 (KB233_07340) ftsY 1577654..1578880 (-) 1227 WP_001830080.1 signal recognition particle-docking protein FtsY -
  KB233_RS07345 (KB233_07345) smc 1578877..1582446 (-) 3570 WP_002502931.1 chromosome segregation protein SMC -
  KB233_RS07350 (KB233_07350) rnc 1582573..1583310 (-) 738 WP_002456575.1 ribonuclease III -
  KB233_RS07355 (KB233_07355) - 1583425..1583658 (-) 234 WP_001830184.1 acyl carrier protein -
  KB233_RS07360 (KB233_07360) fabG 1583886..1584620 (-) 735 WP_001830161.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  KB233_RS07365 (KB233_07365) fabD 1584613..1585539 (-) 927 WP_049323981.1 ACP S-malonyltransferase -
  KB233_RS07370 (KB233_07370) plsX 1585541..1586518 (-) 978 WP_001830112.1 phosphate acyltransferase PlsX -
  KB233_RS07375 (KB233_07375) fapR 1586520..1587080 (-) 561 WP_001830099.1 transcription factor FapR -
  KB233_RS07380 (KB233_07380) recG 1587239..1589287 (-) 2049 WP_001830069.1 ATP-dependent DNA helicase RecG -
  KB233_RS07385 (KB233_07385) fakA 1589491..1591149 (-) 1659 WP_001830116.1 fatty acid kinase catalytic subunit FakA -
  KB233_RS07390 (KB233_07390) - 1591164..1591538 (-) 375 WP_001830156.1 Asp23/Gls24 family envelope stress response protein -
  KB233_RS07395 (KB233_07395) rpmB 1591896..1592084 (+) 189 WP_001830107.1 50S ribosomal protein L28 -
  KB233_RS07400 (KB233_07400) - 1592167..1592802 (-) 636 WP_001830164.1 thiamine diphosphokinase -
  KB233_RS07405 (KB233_07405) rpe 1592807..1593451 (-) 645 WP_001830173.1 ribulose-phosphate 3-epimerase -
  KB233_RS07410 (KB233_07410) rsgA 1593452..1594327 (-) 876 WP_001830137.1 ribosome small subunit-dependent GTPase A -

Sequence


Protein


Download         Length: 290 a.a.        Molecular weight: 33717.61 Da        Isoelectric Point: 9.3616

>NTDB_id=647075 KB233_RS07270 WP_002484839.1 1561692..1562564(-) (dprA) [Staphylococcus epidermidis strain BC1191]
MIQQTMLKLYWANFTTAQLHHLTSTYPDFLSENVFHQHDMIKRWLTERNSERLWNKYERFKELKLMDIIKEMKKANVSFT
TYFDDNYPSLCKEMYDYPYVIFYKGNPQFFNHSHSLAVIGSRNATQYTSQSLNYLFPSFRQLNMAIVSGLARGADSVAHQ
TALKYLLPTIGVLGFGHCYHYPKATLNLRTKVERNGLVISEYPPFSPISKHKFPERNRLISGLSRGVLITEAEERSGSQI
TIDCALEQNRNVYVLPGSMFNKMTKGNLRRINEGAQVVIDESSILYDYLF

Nucleotide


Download         Length: 873 bp        

>NTDB_id=647075 KB233_RS07270 WP_002484839.1 1561692..1562564(-) (dprA) [Staphylococcus epidermidis strain BC1191]
TTGATACAACAGACGATGTTAAAACTATATTGGGCAAATTTCACTACGGCACAACTTCATCATCTTACAAGTACATATCC
TGACTTTCTATCAGAAAACGTATTTCATCAACATGACATGATAAAAAGGTGGCTTACAGAGCGTAATTCTGAAAGGCTAT
GGAACAAATATGAACGTTTCAAAGAATTAAAGCTGATGGACATTATTAAAGAAATGAAAAAAGCAAATGTTAGTTTTACA
ACATACTTTGATGATAACTACCCTTCTCTTTGCAAAGAAATGTATGATTATCCTTATGTGATATTCTACAAAGGAAATCC
ACAGTTCTTTAATCATTCTCACTCTTTAGCTGTAATTGGCTCACGTAATGCCACACAATATACAAGTCAATCTTTAAACT
ATCTTTTTCCTTCATTTAGACAATTAAATATGGCGATTGTTTCTGGATTAGCGCGCGGTGCAGATAGTGTAGCACATCAA
ACCGCACTTAAATACCTATTACCAACTATTGGCGTACTTGGATTTGGCCATTGTTATCATTATCCTAAAGCAACCTTAAA
TTTAAGAACTAAAGTTGAAAGGAATGGCTTAGTGATAAGTGAATATCCACCATTTTCTCCTATAAGTAAGCATAAATTTC
CTGAAAGAAACAGGCTTATAAGTGGTCTGTCCAGAGGGGTACTTATAACTGAGGCTGAAGAAAGAAGTGGTAGTCAAATC
ACTATCGATTGTGCTTTAGAGCAAAATAGAAATGTTTATGTTCTACCTGGTTCAATGTTCAACAAAATGACTAAAGGTAA
TTTAAGAAGGATAAATGAAGGTGCTCAAGTTGTTATAGATGAAAGTAGTATATTATATGATTATCTATTTTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A4Y7VXK4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  dprA Staphylococcus aureus MW2

56.944

99.31

0.566

  dprA Staphylococcus aureus N315

56.944

99.31

0.566