Detailed information    

insolico Bioinformatically predicted

Overview

Name   dprA   Type   Machinery gene
Locus tag   LZT96_RS07710 Genome accession   NZ_CP090941
Coordinates   1631079..1631951 (-) Length   290 a.a.
NCBI ID   WP_002498364.1    Uniprot ID   -
Organism   Staphylococcus epidermidis strain HAF242     
Function   ssDNA binding; loading RecA onto ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1584790..1662496 1631079..1631951 within 0


Gene organization within MGE regions


Location: 1584790..1662496
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LZT96_RS07530 (LZT96_07530) recA 1586341..1587390 (-) 1050 WP_002439552.1 recombinase RecA Machinery gene
  LZT96_RS07535 (LZT96_07535) - 1587561..1588706 (-) 1146 WP_002473662.1 CinA family nicotinamide mononucleotide deamidase-related protein -
  LZT96_RS07540 (LZT96_07540) pgsA 1589671..1590252 (-) 582 WP_002468559.1 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase -
  LZT96_RS07545 (LZT96_07545) - 1590281..1590673 (-) 393 WP_001832565.1 RodZ family helix-turn-helix domain-containing protein -
  LZT96_RS07550 (LZT96_07550) - 1590692..1591519 (-) 828 WP_002456562.1 YmfK family protein -
  LZT96_RS07555 (LZT96_07555) - 1591672..1592376 (-) 705 WP_002468560.1 SDR family oxidoreductase -
  LZT96_RS07560 (LZT96_07560) - 1592373..1593662 (-) 1290 WP_002498352.1 pitrilysin family protein -
  LZT96_RS07565 (LZT96_07565) - 1593662..1594933 (-) 1272 WP_002468568.1 pitrilysin family protein -
  LZT96_RS07570 (LZT96_07570) - 1594963..1595676 (-) 714 WP_002468550.1 GntR family transcriptional regulator -
  LZT96_RS07575 (LZT96_07575) - 1595679..1598072 (-) 2394 WP_203091085.1 DNA translocase FtsK -
  LZT96_RS07580 (LZT96_07580) - 1598338..1600011 (-) 1674 WP_002498354.1 ribonuclease J -
  LZT96_RS07585 (LZT96_07585) pnp 1600379..1602484 (-) 2106 WP_002468566.1 polyribonucleotide nucleotidyltransferase -
  LZT96_RS07590 (LZT96_07590) rpsO 1602616..1602885 (-) 270 WP_002439528.1 30S ribosomal protein S15 -
  LZT96_RS07595 (LZT96_07595) - 1603005..1603976 (-) 972 WP_001832563.1 bifunctional riboflavin kinase/FAD synthetase -
  LZT96_RS07600 (LZT96_07600) truB 1603992..1604909 (-) 918 WP_002498355.1 tRNA pseudouridine(55) synthase TruB -
  LZT96_RS07605 (LZT96_07605) rbfA 1605047..1605397 (-) 351 WP_002498356.1 30S ribosome-binding factor RbfA -
  LZT96_RS07610 (LZT96_07610) infB 1605698..1607860 (-) 2163 WP_002498357.1 translation initiation factor IF-2 -
  LZT96_RS07615 (LZT96_07615) - 1607865..1608182 (-) 318 WP_002439520.1 YlxQ family RNA-binding protein -
  LZT96_RS07620 (LZT96_07620) - 1608182..1608466 (-) 285 WP_002468555.1 YlxR family protein -
  LZT96_RS07625 (LZT96_07625) nusA 1608484..1609707 (-) 1224 WP_002498358.1 transcription termination factor NusA -
  LZT96_RS07630 (LZT96_07630) rimP 1609728..1610195 (-) 468 WP_002498359.1 ribosome maturation factor RimP -
  LZT96_RS07635 (LZT96_07635) - 1610375..1614685 (-) 4311 WP_100214535.1 PolC-type DNA polymerase III -
  LZT96_RS07640 (LZT96_07640) - 1614935..1616638 (-) 1704 WP_002498361.1 proline--tRNA ligase -
  LZT96_RS07645 (LZT96_07645) rseP 1616657..1617943 (-) 1287 WP_001829501.1 RIP metalloprotease RseP -
  LZT96_RS07650 (LZT96_07650) - 1618177..1618959 (-) 783 WP_001829499.1 phosphatidate cytidylyltransferase -
  LZT96_RS07655 (LZT96_07655) - 1618963..1619733 (-) 771 WP_002468551.1 isoprenyl transferase -
  LZT96_RS07660 (LZT96_07660) frr 1619954..1620508 (-) 555 WP_002468545.1 ribosome recycling factor -
  LZT96_RS07665 (LZT96_07665) pyrH 1620525..1621247 (-) 723 WP_002439511.1 UMP kinase -
  LZT96_RS07670 (LZT96_07670) tsf 1621388..1622266 (-) 879 WP_002439509.1 translation elongation factor Ts -
  LZT96_RS07675 (LZT96_07675) rpsB 1622418..1623206 (-) 789 WP_001832557.1 30S ribosomal protein S2 -
  LZT96_RS07680 (LZT96_07680) codY 1623565..1624338 (-) 774 WP_002446289.1 GTP-sensing pleiotropic transcriptional regulator CodY -
  LZT96_RS07685 (LZT96_07685) hslU 1624362..1625765 (-) 1404 WP_001829474.1 ATP-dependent protease ATPase subunit HslU -
  LZT96_RS07690 (LZT96_07690) hslV 1625834..1626376 (-) 543 WP_001829498.1 ATP-dependent protease subunit HslV -
  LZT96_RS07695 (LZT96_07695) xerC 1626380..1627270 (-) 891 WP_002498362.1 tyrosine recombinase XerC -
  LZT96_RS07700 (LZT96_07700) trmFO 1627495..1628802 (-) 1308 WP_002473845.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  LZT96_RS07705 (LZT96_07705) topA 1628827..1630896 (-) 2070 WP_002498363.1 type I DNA topoisomerase -
  LZT96_RS07710 (LZT96_07710) dprA 1631079..1631951 (-) 873 WP_002498364.1 DNA-processing protein DprA Machinery gene
  LZT96_RS07715 (LZT96_07715) - 1632290..1632505 (-) 216 Protein_1490 IS200/IS605 family transposase -
  LZT96_RS07720 (LZT96_07720) sucD 1632755..1633663 (-) 909 WP_002446283.1 succinate--CoA ligase subunit alpha -
  LZT96_RS07725 (LZT96_07725) sucC 1633685..1634851 (-) 1167 WP_002439496.1 ADP-forming succinate--CoA ligase subunit beta -
  LZT96_RS07730 (LZT96_07730) - 1634959..1635729 (-) 771 WP_002498365.1 ribonuclease HII -
  LZT96_RS07735 (LZT96_07735) ylqF 1635734..1636597 (-) 864 WP_002468554.1 ribosome biogenesis GTPase YlqF -
  LZT96_RS07740 (LZT96_07740) - 1636926..1639526 (+) 2601 WP_002498366.1 YfhO family protein -
  LZT96_RS07745 (LZT96_07745) - 1639519..1642122 (+) 2604 WP_002498367.1 YfhO family protein -
  LZT96_RS07750 (LZT96_07750) rplS 1642651..1643001 (-) 351 WP_002436293.1 50S ribosomal protein L19 -
  LZT96_RS07755 (LZT96_07755) trmD 1643107..1643844 (-) 738 WP_002457376.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  LZT96_RS07760 (LZT96_07760) rimM 1643844..1644347 (-) 504 WP_002498368.1 ribosome maturation factor RimM -
  LZT96_RS07765 (LZT96_07765) rpsP 1644474..1644749 (-) 276 WP_002439483.1 30S ribosomal protein S16 -
  LZT96_RS07770 (LZT96_07770) ffh 1645243..1646610 (-) 1368 WP_254582786.1 signal recognition particle protein -
  LZT96_RS07775 (LZT96_07775) - 1646641..1646973 (-) 333 WP_002473260.1 putative DNA-binding protein -
  LZT96_RS07780 (LZT96_07780) ftsY 1646975..1648201 (-) 1227 WP_002473240.1 signal recognition particle-docking protein FtsY -
  LZT96_RS07785 (LZT96_07785) smc 1648198..1651767 (-) 3570 WP_002498370.1 chromosome segregation protein SMC -
  LZT96_RS07790 (LZT96_07790) rnc 1651894..1652631 (-) 738 WP_002498371.1 ribonuclease III -
  LZT96_RS07795 (LZT96_07795) - 1652746..1652979 (-) 234 WP_001830184.1 acyl carrier protein -
  LZT96_RS07800 (LZT96_07800) fabG 1653142..1653876 (-) 735 WP_002498372.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  LZT96_RS07805 (LZT96_07805) fabD 1653869..1654795 (-) 927 WP_002473278.1 ACP S-malonyltransferase -
  LZT96_RS07810 (LZT96_07810) plsX 1654797..1655774 (-) 978 WP_002498373.1 phosphate acyltransferase PlsX -
  LZT96_RS07815 (LZT96_07815) fapR 1655776..1656336 (-) 561 WP_001830099.1 transcription factor FapR -
  LZT96_RS07820 (LZT96_07820) recG 1656495..1658543 (-) 2049 WP_002498374.1 ATP-dependent DNA helicase RecG -
  LZT96_RS07825 (LZT96_07825) fakA 1658748..1660406 (-) 1659 WP_002498375.1 fatty acid kinase catalytic subunit FakA -
  LZT96_RS07830 (LZT96_07830) - 1660421..1660795 (-) 375 WP_001830156.1 Asp23/Gls24 family envelope stress response protein -
  LZT96_RS07835 (LZT96_07835) rpmB 1661153..1661341 (+) 189 WP_001830107.1 50S ribosomal protein L28 -
  LZT96_RS07840 (LZT96_07840) - 1661424..1662059 (-) 636 WP_002498376.1 thiamine diphosphokinase -

Sequence

Protein


Download         Length: 290 a.a.        Molecular weight: 33812.77 Da        Isoelectric Point: 9.4784

>NTDB_id=646590 LZT96_RS07710 WP_002498364.1 1631079..1631951(-) (dprA) [Staphylococcus epidermidis strain HAF242]
MIQHTMLKLYWANFTTAQLHHLTRTYPDFLSENVFHQHDMIKRWLTERNSERLWNKYERFKELKMMDIIKEMKKANVSFT
TYFDDNYPSLCKEMYDYPYVIFYKGNPQFFNHSHSLAVIGSRNATQYTSQSLNYLFPSFRQLNMAIVSGLARGADSVAHQ
TALKYLLPTIGVLGFGHCYHYPKATLNLRTKVERNGLVISEYPPFSPINKHKFPERNRLISGLSKGVLITEAEERSGSQI
TIDCALEQNRNVYVLPGSMFNKMTKGNLRRINEGAQVVIDESSILYDYLF

Nucleotide


Download         Length: 873 bp        

>NTDB_id=646590 LZT96_RS07710 WP_002498364.1 1631079..1631951(-) (dprA) [Staphylococcus epidermidis strain HAF242]
TTGATACAACATACGATGTTAAAACTATATTGGGCAAATTTCACTACGGCACAACTTCATCATCTTACACGTACATATCC
TGACTTTCTATCAGAAAACGTATTTCATCAACATGACATGATAAAAAGGTGGCTTACAGAGCGTAATTCTGAAAGACTAT
GGAACAAATATGAACGTTTCAAAGAATTAAAGATGATGGACATTATTAAAGAAATGAAAAAAGCAAATGTTAGTTTTACA
ACATACTTTGATGATAACTACCCTTCTCTTTGCAAAGAAATGTATGATTATCCTTATGTGATATTCTACAAAGGAAATCC
ACAGTTCTTTAATCATTCACACTCTTTAGCTGTAATTGGCTCACGTAATGCCACACAATATACAAGTCAATCTTTAAACT
ATCTTTTTCCTTCATTTAGACAATTAAATATGGCGATTGTTTCTGGATTAGCGCGCGGTGCAGATAGTGTAGCACATCAA
ACCGCACTTAAATACTTATTACCAACTATTGGCGTACTTGGATTTGGCCATTGTTATCATTATCCTAAAGCAACCTTAAA
TTTAAGAACTAAAGTTGAAAGGAATGGCTTAGTGATAAGTGAATATCCACCATTTTCTCCTATAAATAAGCATAAATTTC
CTGAAAGAAACAGGCTTATAAGTGGTCTGTCCAAAGGGGTGCTTATAACTGAGGCTGAAGAAAGAAGTGGTAGTCAAATC
ACTATCGATTGTGCTTTAGAGCAAAATAGAAATGTTTATGTTCTACCTGGTTCAATGTTCAACAAAATGACTAAAGGTAA
TTTAAGAAGGATAAATGAAGGTGCTCAAGTTGTTATAGATGAAAGTAGTATATTATATGATTATCTATTTTAG

Domains

Predicted by InterproScan.

DNA recombination-mediator protein A (DNA_processg_A)

(72-279)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  dprA Staphylococcus aureus MW2

57.292

99.31

0.569
  dprA Staphylococcus aureus N315

57.292

99.31

0.569