Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   KB230_RS09095 Genome accession   NZ_CP090922
Coordinates   1934826..1935377 (-) Length   183 a.a.
NCBI ID   WP_115338917.1    Uniprot ID   -
Organism   Staphylococcus epidermidis strain 45A6     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1902824..1945386 1934826..1935377 within 0


Gene organization within MGE regions


Location: 1902824..1945386
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KB230_RS08865 (KB230_08865) - 1902824..1903003 (-) 180 WP_002468147.1 hypothetical protein -
  KB230_RS08875 (KB230_08875) - 1903536..1903657 (-) 122 Protein_1727 hypothetical protein -
  KB230_RS08880 (KB230_08880) - 1904096..1905559 (-) 1464 WP_145360475.1 SH3 domain-containing protein -
  KB230_RS08885 (KB230_08885) - 1905534..1905944 (-) 411 WP_115338941.1 phage holin -
  KB230_RS08890 (KB230_08890) - 1906008..1906406 (-) 399 WP_115338940.1 YxeA family protein -
  KB230_RS08895 (KB230_08895) - 1906564..1906971 (-) 408 Protein_1731 hypothetical protein -
  KB230_RS08900 (KB230_08900) - 1906958..1907383 (-) 426 WP_002503483.1 hypothetical protein -
  KB230_RS08905 (KB230_08905) - 1907380..1908003 (-) 624 WP_115339066.1 poly-gamma-glutamate hydrolase family protein -
  KB230_RS08910 (KB230_08910) - 1908008..1909222 (-) 1215 WP_115338938.1 BppU family phage baseplate upper protein -
  KB230_RS08915 (KB230_08915) - 1909222..1911084 (-) 1863 WP_234967003.1 M14 family metallopeptidase -
  KB230_RS08920 (KB230_08920) - 1911075..1911272 (-) 198 WP_186310792.1 hypothetical protein -
  KB230_RS08925 (KB230_08925) - 1911265..1912824 (-) 1560 WP_181876173.1 prophage endopeptidase tail family protein -
  KB230_RS08930 (KB230_08930) - 1912834..1913667 (-) 834 WP_115338935.1 phage tail domain-containing protein -
  KB230_RS08935 (KB230_08935) - 1913669..1918165 (-) 4497 WP_203079454.1 tape measure protein -
  KB230_RS08940 (KB230_08940) gpGT 1918194..1918346 (-) 153 WP_156673588.1 phage tail assembly chaperone GT -
  KB230_RS08945 (KB230_08945) gpG 1918379..1918741 (-) 363 WP_002474269.1 phage tail assembly chaperone G -
  KB230_RS08950 (KB230_08950) - 1918812..1918997 (-) 186 WP_115338933.1 hypothetical protein -
  KB230_RS08955 (KB230_08955) - 1919016..1919645 (-) 630 WP_115338932.1 major tail protein -
  KB230_RS08960 (KB230_08960) - 1919658..1920062 (-) 405 WP_115338931.1 hypothetical protein -
  KB230_RS08965 (KB230_08965) - 1920067..1920471 (-) 405 WP_115338930.1 hypothetical protein -
  KB230_RS08970 (KB230_08970) - 1920468..1920797 (-) 330 WP_002456401.1 hypothetical protein -
  KB230_RS08975 (KB230_08975) - 1920787..1921128 (-) 342 WP_002456400.1 head-tail connector protein -
  KB230_RS08980 (KB230_08980) - 1921147..1922502 (-) 1356 WP_145360467.1 phage major capsid protein -
  KB230_RS08985 (KB230_08985) - 1922542..1923099 (-) 558 WP_002503468.1 HK97 family phage prohead protease -
  KB230_RS08990 (KB230_08990) - 1923089..1924321 (-) 1233 WP_145374044.1 phage portal protein -
  KB230_RS08995 (KB230_08995) - 1924321..1924515 (-) 195 WP_115338927.1 hypothetical protein -
  KB230_RS09000 (KB230_09000) - 1924529..1926280 (-) 1752 WP_234967004.1 terminase large subunit -
  KB230_RS09005 (KB230_09005) - 1926273..1926738 (-) 466 Protein_1753 phage terminase small subunit P27 family -
  KB230_RS09015 (KB230_09015) - 1926881..1927231 (-) 351 WP_115338924.1 HNH endonuclease -
  KB230_RS09020 (KB230_09020) - 1927784..1928230 (-) 447 WP_002474286.1 transcriptional regulator -
  KB230_RS09025 (KB230_09025) rinB 1928439..1928579 (-) 141 WP_002474213.1 transcriptional activator RinB -
  KB230_RS09030 (KB230_09030) - 1928684..1928986 (+) 303 WP_234967007.1 hypothetical protein -
  KB230_RS09035 (KB230_09035) - 1929107..1929529 (-) 423 WP_115338922.1 dUTP diphosphatase -
  KB230_RS09040 (KB230_09040) - 1929586..1929903 (+) 318 WP_216088309.1 hypothetical protein -
  KB230_RS11720 - 1929921..1930049 (-) 129 WP_258844618.1 hypothetical protein -
  KB230_RS09045 (KB230_09045) - 1930046..1930399 (-) 354 WP_002474295.1 SA1788 family PVL leukocidin-associated protein -
  KB230_RS09050 (KB230_09050) - 1930418..1930774 (-) 357 WP_002474240.1 helix-turn-helix domain-containing protein -
  KB230_RS09055 (KB230_09055) - 1930775..1930960 (-) 186 WP_002474304.1 hypothetical protein -
  KB230_RS09060 (KB230_09060) - 1930957..1931367 (-) 411 WP_002503455.1 DUF1064 domain-containing protein -
  KB230_RS09065 (KB230_09065) - 1931377..1931622 (-) 246 WP_002503454.1 hypothetical protein -
  KB230_RS09070 (KB230_09070) - 1931622..1931783 (-) 162 WP_171769806.1 hypothetical protein -
  KB230_RS09075 (KB230_09075) - 1931777..1932547 (-) 771 WP_115338921.1 ATP-binding protein -
  KB230_RS09080 (KB230_09080) - 1932558..1933328 (-) 771 WP_002503452.1 conserved phage C-terminal domain-containing protein -
  KB230_RS09085 (KB230_09085) - 1933403..1934059 (+) 657 WP_145374047.1 hypothetical protein -
  KB230_RS09090 (KB230_09090) - 1934140..1934814 (-) 675 WP_145360460.1 putative HNHc nuclease -
  KB230_RS09095 (KB230_09095) ssbA 1934826..1935377 (-) 552 WP_115338917.1 single-stranded DNA-binding protein Machinery gene
  KB230_RS09100 (KB230_09100) - 1935380..1936003 (-) 624 WP_115338916.1 ERF family protein -
  KB230_RS09105 (KB230_09105) - 1936004..1936489 (-) 486 WP_115338915.1 siphovirus Gp157 family protein -
  KB230_RS09110 (KB230_09110) - 1936482..1936736 (-) 255 WP_115338914.1 hypothetical protein -
  KB230_RS09115 (KB230_09115) - 1936802..1936984 (-) 183 WP_032603798.1 hypothetical protein -
  KB230_RS09120 (KB230_09120) - 1936981..1937196 (-) 216 WP_002474300.1 hypothetical protein -
  KB230_RS09125 (KB230_09125) - 1937305..1937508 (+) 204 WP_002468183.1 hypothetical protein -
  KB230_RS09130 (KB230_09130) - 1937616..1938104 (-) 489 WP_234967008.1 ORF6C domain-containing protein -
  KB230_RS09135 (KB230_09135) - 1938356..1938577 (-) 222 WP_115338913.1 hypothetical protein -
  KB230_RS09140 (KB230_09140) - 1938796..1939134 (+) 339 WP_115338912.1 hypothetical protein -
  KB230_RS09145 (KB230_09145) - 1939120..1939353 (-) 234 WP_115338911.1 MW1434 family type I TA system toxin -
  KB230_RS09150 (KB230_09150) - 1939365..1940249 (-) 885 WP_115338910.1 hypothetical protein -
  KB230_RS09155 (KB230_09155) - 1940276..1940503 (-) 228 WP_115338909.1 BetR domain protein -
  KB230_RS09160 (KB230_09160) - 1940675..1941286 (+) 612 WP_145374050.1 LexA family protein -
  KB230_RS09165 (KB230_09165) - 1941329..1941496 (+) 168 WP_168989918.1 hypothetical protein -
  KB230_RS09170 (KB230_09170) - 1941518..1942657 (+) 1140 WP_145360455.1 CapA family protein -
  KB230_RS09175 (KB230_09175) - 1942872..1943921 (+) 1050 WP_115338907.1 site-specific integrase -
  KB230_RS09180 (KB230_09180) sufB 1943989..1945386 (-) 1398 WP_002498327.1 Fe-S cluster assembly protein SufB -

Sequence

Protein


Download         Length: 183 a.a.        Molecular weight: 20810.48 Da        Isoelectric Point: 8.3348

>NTDB_id=646490 KB230_RS09095 WP_115338917.1 1934826..1935377(-) (ssbA) [Staphylococcus epidermidis strain 45A6]
MINRVVLAGRLTKDPEFRQTASGVSVTTFSLAVNRTFKNKNGEREADFINVVVFRQQAENVNNYLSKGSLAGVDGRIQSR
SYDNNEGRRVFVTEVVADNIQFLDSGNKNNNQKGNYQQKNNNHQQNNGYQPNNNYQPPQQSNSYQPPQQNQNSYQQPQQQ
NQQQNPFANANGPLDIQDEDLPF

Nucleotide


Download         Length: 552 bp        

>NTDB_id=646490 KB230_RS09095 WP_115338917.1 1934826..1935377(-) (ssbA) [Staphylococcus epidermidis strain 45A6]
ATGATAAACAGAGTAGTTTTAGCAGGTAGATTAACAAAAGATCCAGAGTTCAGACAAACAGCAAGCGGCGTAAGTGTAAC
CACATTTTCATTAGCAGTAAATAGAACATTCAAAAACAAAAATGGCGAAAGAGAAGCAGATTTTATTAATGTAGTTGTAT
TTAGACAACAAGCAGAAAACGTTAATAACTATCTTTCAAAAGGTAGTTTAGCTGGAGTAGATGGGCGTATTCAATCACGA
AGTTATGACAACAACGAAGGGCGACGTGTTTTTGTGACGGAAGTTGTAGCAGATAATATTCAATTCCTAGATAGTGGAAA
TAAAAACAACAATCAAAAAGGTAATTATCAACAGAAAAACAATAACCATCAACAAAATAATGGCTATCAACCCAATAATA
ATTACCAACCACCTCAACAAAGCAATAGCTATCAACCACCACAGCAAAATCAAAATAGTTACCAACAGCCACAACAACAG
AATCAACAACAAAATCCATTTGCTAACGCTAATGGTCCGTTAGATATTCAAGATGAGGATTTACCTTTCTAG

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

53.005

100

0.53
  ssb Latilactobacillus sakei subsp. sakei 23K

49.727

100

0.497