Detailed information    

insolico Bioinformatically predicted

Overview

Name   dprA   Type   Machinery gene
Locus tag   KB229_RS07745 Genome accession   NZ_CP090915
Coordinates   1625607..1626479 (-) Length   290 a.a.
NCBI ID   WP_234965817.1    Uniprot ID   -
Organism   Staphylococcus epidermidis strain 45A5     
Function   ssDNA binding; loading RecA onto ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1578969..1655298 1625607..1626479 within 0


Gene organization within MGE regions


Location: 1578969..1655298
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KB229_RS07555 (KB229_07555) - 1579295..1579510 (+) 216 WP_234965804.1 hypothetical protein -
  KB229_RS07560 (KB229_07560) rny 1579600..1581159 (-) 1560 WP_047500300.1 ribonuclease Y -
  KB229_RS07565 (KB229_07565) recA 1581385..1582434 (-) 1050 WP_002439552.1 recombinase RecA Machinery gene
  KB229_RS07570 (KB229_07570) - 1582605..1583750 (-) 1146 WP_002439549.1 CinA family nicotinamide mononucleotide deamidase-related protein -
  KB229_RS07575 (KB229_07575) pgsA 1584203..1584784 (-) 582 WP_002439546.1 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase -
  KB229_RS07580 (KB229_07580) - 1584813..1585205 (-) 393 WP_001832565.1 helix-turn-helix domain-containing protein -
  KB229_RS07585 (KB229_07585) - 1585224..1586051 (-) 828 WP_002456221.1 YmfK family protein -
  KB229_RS07590 (KB229_07590) ymfI 1586204..1586908 (-) 705 WP_002439542.1 elongation factor P 5-aminopentanone reductase -
  KB229_RS07595 (KB229_07595) yfmH 1586905..1588194 (-) 1290 WP_001832569.1 EF-P 5-aminopentanol modification-associated protein YfmH -
  KB229_RS07600 (KB229_07600) yfmF 1588194..1589465 (-) 1272 WP_234965805.1 EF-P 5-aminopentanol modification-associated protein YfmF -
  KB229_RS07605 (KB229_07605) - 1589496..1590209 (-) 714 WP_002439536.1 GntR family transcriptional regulator -
  KB229_RS07610 (KB229_07610) - 1590212..1592605 (-) 2394 WP_002439534.1 DNA translocase FtsK -
  KB229_RS07615 (KB229_07615) rnjB 1592871..1594544 (-) 1674 WP_234965807.1 ribonuclease J2 -
  KB229_RS07620 (KB229_07620) pnp 1594912..1597017 (-) 2106 WP_234965809.1 polyribonucleotide nucleotidyltransferase -
  KB229_RS07625 (KB229_07625) rpsO 1597149..1597418 (-) 270 WP_234965811.1 30S ribosomal protein S15 -
  KB229_RS07630 (KB229_07630) - 1597538..1598509 (-) 972 WP_001832563.1 bifunctional riboflavin kinase/FAD synthetase -
  KB229_RS07635 (KB229_07635) truB 1598525..1599442 (-) 918 WP_002456563.1 tRNA pseudouridine(55) synthase TruB -
  KB229_RS07640 (KB229_07640) rbfA 1599580..1599930 (-) 351 WP_001829509.1 30S ribosome-binding factor RbfA -
  KB229_RS07645 (KB229_07645) infB 1600233..1602395 (-) 2163 WP_002468903.1 translation initiation factor IF-2 -
  KB229_RS07650 (KB229_07650) - 1602400..1602717 (-) 318 WP_002439520.1 YlxQ family RNA-binding protein -
  KB229_RS07655 (KB229_07655) rnpM 1602717..1603001 (-) 285 WP_001829465.1 RNase P modulator RnpM -
  KB229_RS07660 (KB229_07660) nusA 1603019..1604242 (-) 1224 WP_234965813.1 transcription termination factor NusA -
  KB229_RS07665 (KB229_07665) rimP 1604263..1604730 (-) 468 WP_002439519.1 ribosome maturation factor RimP -
  KB229_RS07670 (KB229_07670) - 1604909..1609219 (-) 4311 WP_234966579.1 PolC-type DNA polymerase III -
  KB229_RS07675 (KB229_07675) - 1609469..1611172 (-) 1704 WP_001829513.1 proline--tRNA ligase -
  KB229_RS07680 (KB229_07680) rseP 1611191..1612477 (-) 1287 WP_001829501.1 RIP metalloprotease RseP -
  KB229_RS07685 (KB229_07685) - 1612704..1613486 (-) 783 WP_001829499.1 phosphatidate cytidylyltransferase -
  KB229_RS07690 (KB229_07690) - 1613490..1614260 (-) 771 WP_001832561.1 isoprenyl transferase -
  KB229_RS07695 (KB229_07695) frr 1614481..1615035 (-) 555 WP_001829472.1 ribosome recycling factor -
  KB229_RS07700 (KB229_07700) pyrH 1615052..1615774 (-) 723 WP_002439511.1 UMP kinase -
  KB229_RS07705 (KB229_07705) tsf 1615915..1616793 (-) 879 WP_234965815.1 translation elongation factor Ts -
  KB229_RS07710 (KB229_07710) rpsB 1616945..1617733 (-) 789 WP_001832557.1 30S ribosomal protein S2 -
  KB229_RS07715 (KB229_07715) codY 1618096..1618866 (-) 771 WP_002439506.1 GTP-sensing pleiotropic transcriptional regulator CodY -
  KB229_RS07720 (KB229_07720) hslU 1618890..1620293 (-) 1404 WP_234965816.1 ATP-dependent protease ATPase subunit HslU -
  KB229_RS07725 (KB229_07725) hslV 1620362..1620904 (-) 543 WP_001829498.1 ATP-dependent protease subunit HslV -
  KB229_RS07730 (KB229_07730) xerC 1620908..1621768 (-) 861 WP_002439503.1 tyrosine recombinase XerC -
  KB229_RS07735 (KB229_07735) trmFO 1622023..1623330 (-) 1308 WP_001832560.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  KB229_RS07740 (KB229_07740) topA 1623355..1625424 (-) 2070 WP_001829508.1 type I DNA topoisomerase -
  KB229_RS07745 (KB229_07745) dprA 1625607..1626479 (-) 873 WP_234965817.1 DNA-processing protein DprA Machinery gene
  KB229_RS07755 (KB229_07755) sucD 1627284..1628192 (-) 909 WP_002446283.1 succinate--CoA ligase subunit alpha -
  KB229_RS07760 (KB229_07760) sucC 1628214..1629380 (-) 1167 WP_002439496.1 ADP-forming succinate--CoA ligase subunit beta -
  KB229_RS07765 (KB229_07765) - 1629488..1630258 (-) 771 WP_001829514.1 ribonuclease HII -
  KB229_RS07770 (KB229_07770) ylqF 1630263..1631126 (-) 864 WP_002468554.1 ribosome biogenesis GTPase YlqF -
  KB229_RS07775 (KB229_07775) - 1631455..1634055 (+) 2601 WP_115338965.1 YfhO family protein -
  KB229_RS07780 (KB229_07780) - 1634048..1636651 (+) 2604 WP_234965818.1 YfhO family protein -
  KB229_RS07785 (KB229_07785) rplS 1637181..1637531 (-) 351 WP_002436293.1 50S ribosomal protein L19 -
  KB229_RS07790 (KB229_07790) trmD 1637637..1638374 (-) 738 WP_001829466.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  KB229_RS07795 (KB229_07795) rimM 1638374..1638877 (-) 504 WP_001832559.1 ribosome maturation factor RimM -
  KB229_RS07800 (KB229_07800) rpsP 1639004..1639279 (-) 276 WP_002439483.1 30S ribosomal protein S16 -
  KB229_RS07805 (KB229_07805) ffh 1639587..1640954 (-) 1368 WP_234965819.1 signal recognition particle protein -
  KB229_RS07810 (KB229_07810) - 1640985..1641317 (-) 333 WP_001830102.1 putative DNA-binding protein -
  KB229_RS07815 (KB229_07815) ftsY 1641319..1642545 (-) 1227 WP_001830080.1 signal recognition particle-docking protein FtsY -
  KB229_RS07820 (KB229_07820) smc 1642542..1646111 (-) 3570 WP_234965820.1 chromosome segregation protein SMC -
  KB229_RS07825 (KB229_07825) rnc 1646238..1646975 (-) 738 WP_001830158.1 ribonuclease III -
  KB229_RS07830 (KB229_07830) - 1647090..1647323 (-) 234 WP_001830184.1 acyl carrier protein -
  KB229_RS07835 (KB229_07835) fabG 1647487..1648221 (-) 735 WP_234965821.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  KB229_RS07840 (KB229_07840) fabD 1648214..1649140 (-) 927 WP_234965822.1 ACP S-malonyltransferase -
  KB229_RS07845 (KB229_07845) plsX 1649142..1650119 (-) 978 WP_001830112.1 phosphate acyltransferase PlsX -
  KB229_RS07850 (KB229_07850) fapR 1650121..1650681 (-) 561 WP_001830099.1 transcription factor FapR -
  KB229_RS07855 (KB229_07855) recG 1650840..1652888 (-) 2049 WP_234965824.1 ATP-dependent DNA helicase RecG -
  KB229_RS07860 (KB229_07860) fakA 1653092..1654750 (-) 1659 WP_234965825.1 fatty acid kinase catalytic subunit FakA -
  KB229_RS07865 (KB229_07865) - 1654765..1655139 (-) 375 WP_001830156.1 Asp23/Gls24 family envelope stress response protein -

Sequence

Protein


Download         Length: 290 a.a.        Molecular weight: 33682.61 Da        Isoelectric Point: 9.4835

>NTDB_id=646453 KB229_RS07745 WP_234965817.1 1625607..1626479(-) (dprA) [Staphylococcus epidermidis strain 45A5]
MIQHTMLKLYWANFTTAQLHHLTSTYPDFLSENVFHQHDMIKRWLTERNSERLWNKYERFKELKLMDIIKEMKKANVSFT
TYFDDNYPSLCKEMYDYPYVIFYKGNPQFFNHSHSLAVIGSRNATQYTSQSLNYLFPSFRQLNMAIVSGLVRGADSVAHQ
TALKYLLPTIGVLGFGHCYHYPKATLNLRTKVERNGLVISEYPPFSPISKHKFPGRNRLISGLSRGVLITEAEERSGSQI
TIDCALEQNRNVYVLPGSMFNKMTKGNLRRINEGAQVVIDESSILYDYLF

Nucleotide


Download         Length: 873 bp        

>NTDB_id=646453 KB229_RS07745 WP_234965817.1 1625607..1626479(-) (dprA) [Staphylococcus epidermidis strain 45A5]
TTGATACAACATACGATGTTAAAACTATATTGGGCAAATTTCACTACGGCACAACTTCATCATCTTACAAGTACATATCC
TGACTTTCTATCAGAAAACGTATTTCATCAACATGACATGATAAAAAGGTGGCTTACAGAGCGTAATTCTGAAAGGCTAT
GGAACAAATATGAACGTTTCAAAGAATTAAAGCTGATGGACATTATTAAAGAAATGAAAAAAGCAAATGTTAGTTTTACA
ACATACTTTGATGATAACTACCCTTCTCTTTGCAAAGAAATGTATGATTATCCTTATGTGATATTCTACAAAGGAAATCC
ACAGTTCTTTAATCATTCTCACTCTTTAGCTGTAATTGGCTCACGTAATGCCACACAATATACAAGTCAATCTTTAAACT
ATCTTTTTCCTTCATTTAGACAATTAAATATGGCGATTGTTTCTGGATTAGTGCGCGGTGCAGATAGTGTAGCACATCAA
ACCGCACTTAAATACCTATTACCAACTATTGGCGTACTTGGATTTGGCCATTGTTATCATTATCCTAAAGCAACCTTAAA
TTTAAGAACTAAAGTTGAAAGGAATGGCTTAGTGATAAGTGAATATCCACCATTTTCTCCTATAAGTAAGCATAAATTTC
CTGGAAGAAACAGGCTTATAAGTGGTCTGTCCAGAGGGGTACTTATAACTGAGGCTGAAGAAAGAAGTGGTAGTCAAATC
ACTATCGATTGTGCTTTAGAGCAAAATAGAAATGTTTATGTTCTACCTGGTTCAATGTTCAACAAAATGACTAAAGGTAA
TTTAAGAAGGATAAATGAAGGTGCTCAAGTTGTTATAGATGAAAGTAGTATATTATATGATTATCTATTTTAG

Domains

Predicted by InterproScan.

DNA recombination-mediator protein A (DNA_processg_A)

(72-279)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  dprA Staphylococcus aureus MW2

56.25

99.31

0.559
  dprA Staphylococcus aureus N315

56.25

99.31

0.559