Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   L0961_RS01955 Genome accession   NZ_CP090905
Coordinates   384576..384695 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain Yao     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 379576..389695
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  L0961_RS01940 (L0961_01940) - 381188..381871 (+) 684 WP_015388707.1 response regulator transcription factor -
  L0961_RS01945 (L0961_01945) - 381858..383291 (+) 1434 WP_161620115.1 sensor histidine kinase -
  L0961_RS01950 (L0961_01950) rapC 383444..384592 (+) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  L0961_RS01955 (L0961_01955) phrC 384576..384695 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  L0961_RS01960 (L0961_01960) - 384845..384955 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  L0961_RS01965 (L0961_01965) - 385035..386399 (-) 1365 WP_014304341.1 aspartate kinase -
  L0961_RS01970 (L0961_01970) ceuB 386814..387767 (+) 954 WP_003156332.1 ABC transporter permease Machinery gene
  L0961_RS01975 (L0961_01975) - 387757..388704 (+) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  L0961_RS01980 (L0961_01980) - 388698..389456 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=646279 L0961_RS01955 WP_003156334.1 384576..384695(+) (phrC) [Bacillus velezensis strain Yao]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=646279 L0961_RS01955 WP_003156334.1 384576..384695(+) (phrC) [Bacillus velezensis strain Yao]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718