Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   LT978_RS07585 Genome accession   NZ_CP090838
Coordinates   1468458..1468631 (-) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus amyloliquefaciens strain TL106     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1463458..1473631
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LT978_RS07535 (LT978_07530) comGD 1463578..1464015 (+) 438 WP_043867285.1 competence type IV pilus minor pilin ComGD Machinery gene
  LT978_RS07540 (LT978_07535) comGE 1463999..1464313 (+) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  LT978_RS07545 (LT978_07540) comGF 1464327..1464722 (+) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  LT978_RS07550 (LT978_07545) comGG 1464723..1465100 (+) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  LT978_RS07555 (LT978_07550) - 1465157..1465336 (+) 180 WP_003153093.1 YqzE family protein -
  LT978_RS07560 (LT978_07555) - 1465376..1465705 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  LT978_RS07565 (LT978_07560) tapA 1465965..1466636 (+) 672 WP_015388007.1 amyloid fiber anchoring/assembly protein TapA -
  LT978_RS07570 (LT978_07565) sipW 1466608..1467192 (+) 585 WP_109567595.1 signal peptidase I SipW -
  LT978_RS07575 (LT978_07570) tasA 1467256..1468041 (+) 786 WP_015388008.1 biofilm matrix protein TasA -
  LT978_RS07580 (LT978_07575) sinR 1468089..1468424 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LT978_RS07585 (LT978_07580) sinI 1468458..1468631 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  LT978_RS07590 (LT978_07585) - 1468808..1469602 (-) 795 WP_139890050.1 YqhG family protein -
  LT978_RS07595 (LT978_07590) - 1469620..1471290 (-) 1671 WP_003153107.1 SNF2-related protein -
  LT978_RS07600 (LT978_07595) gcvT 1471713..1472813 (+) 1101 WP_014305405.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=645067 LT978_RS07585 WP_003153105.1 1468458..1468631(-) (sinI) [Bacillus amyloliquefaciens strain TL106]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=645067 LT978_RS07585 WP_003153105.1 1468458..1468631(-) (sinI) [Bacillus amyloliquefaciens strain TL106]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702