Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   U722_RS11750 Genome accession   NC_023073
Coordinates   2508847..2509113 (-) Length   88 a.a.
NCBI ID   WP_042635730.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens LFB112     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2503847..2514113
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  U722_RS11700 (U722_12485) sinR 2504011..2504346 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  U722_RS11705 (U722_12490) tasA 2504394..2505179 (-) 786 WP_015388008.1 biofilm matrix protein TasA -
  U722_RS11710 (U722_12495) sipW 2505243..2505827 (-) 585 WP_003153100.1 signal peptidase I SipW -
  U722_RS11715 (U722_12500) tapA 2505799..2506470 (-) 672 WP_024085598.1 amyloid fiber anchoring/assembly protein TapA -
  U722_RS11720 (U722_12505) - 2506730..2507059 (+) 330 WP_024085599.1 DUF3889 domain-containing protein -
  U722_RS11725 (U722_12510) - 2507099..2507278 (-) 180 WP_003153093.1 YqzE family protein -
  U722_RS11730 (U722_12515) comGG 2507335..2507712 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  U722_RS11735 (U722_12520) comGF 2507713..2508108 (-) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  U722_RS11740 (U722_12525) comGE 2508122..2508436 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  U722_RS11745 (U722_12530) comGD 2508420..2508857 (-) 438 WP_024085600.1 competence type IV pilus minor pilin ComGD Machinery gene
  U722_RS11750 (U722_12535) comGC 2508847..2509113 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  U722_RS11755 (U722_12540) comGB 2509160..2510197 (-) 1038 WP_024085602.1 competence type IV pilus assembly protein ComGB Machinery gene
  U722_RS11760 (U722_12545) comGA 2510184..2511254 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  U722_RS11765 (U722_12550) - 2511446..2512396 (-) 951 WP_014305415.1 magnesium transporter CorA family protein -
  U722_RS11770 (U722_12555) - 2512542..2513843 (+) 1302 WP_014305416.1 hemolysin family protein -

Sequence


Protein


Download         Length: 88 a.a.        Molecular weight: 9721.32 Da        Isoelectric Point: 6.2027

>NTDB_id=64203 U722_RS11750 WP_042635730.1 2508847..2509113(-) (comGC) [Bacillus amyloliquefaciens LFB112]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=64203 U722_RS11750 WP_042635730.1 2508847..2509113(-) (comGC) [Bacillus amyloliquefaciens LFB112]
ATGCTGATCGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGACCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602


Multiple sequence alignment