Detailed information NTG0637252

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: LUY97_RS02580
• Genome accession: NZ_CP089483
• Coordinates: 482771..483082 (+)
• Length: 103 a.a.
• NCBI ID: WP_000472256.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain 0104_III_ST239
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 477771..488082

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LUY97_RS02550	-	478555..478758 (+)	204	WP_000087561.1	YqgQ family protein	-
LUY97_RS02555	-	478755..479741 (+)	987	WP_000161314.1	ROK family glucokinase	-
LUY97_RS02560	-	479741..480070 (+)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
LUY97_RS02565	-	480067..480690 (+)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
LUY97_RS02570	comGA	480741..481715 (+)	975	WP_000697228.1	competence type IV pilus ATPase ComGA	Machinery gene
LUY97_RS02575	comGB	481687..482757 (+)	1071	WP_000775708.1	competence type IV pilus assembly protein ComGB	Machinery gene
LUY97_RS02580	comGC	482771..483082 (+)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
LUY97_RS02585	comGD	483060..483506 (+)	447	WP_001790850.1	competence type IV pilus minor pilin ComGD	Machinery gene
LUY97_RS02590	comGE	483493..483792 (+)	300	WP_000844413.1	hypothetical protein	Machinery gene
LUY97_RS02595	comGF	483710..484207 (+)	498	WP_001789864.1	competence type IV pilus minor pilin ComGF	Machinery gene
LUY97_RS02600	-	484304..484450 (+)	147	WP_001789879.1	hypothetical protein	-
LUY97_RS02605	-	484440..484964 (+)	525	WP_001015117.1	shikimate kinase	-
LUY97_RS02610	gcvT	485123..486214 (+)	1092	WP_000093349.1	glycine cleavage system aminomethyltransferase GcvT	-
LUY97_RS02615	gcvPA	486234..487580 (+)	1347	WP_000019687.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11315.36 Da
• Isoelectric Point: 8.5268

>NTDB_id=637252 LUY97_RS02580 WP_000472256.1 482771..483082(+) (comGC) [Staphylococcus aureus strain 0104_III_ST239]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=637252 LUY97_RS02580 WP_000472256.1 482771..483082(+) (comGC) [Staphylococcus aureus strain 0104_III_ST239]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369