Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   LT232_RS17910 Genome accession   NZ_CP089287
Coordinates   3609000..3609140 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain GSBZ09     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3604000..3614140
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LT232_RS17885 (LT232_17885) - 3604306..3604704 (+) 399 WP_015240486.1 YueI family protein -
  LT232_RS17890 (LT232_17890) - 3604801..3605352 (+) 552 WP_003152033.1 cysteine hydrolase family protein -
  LT232_RS17895 (LT232_17895) - 3605370..3606836 (+) 1467 WP_015418109.1 nicotinate phosphoribosyltransferase -
  LT232_RS17900 (LT232_17900) - 3606966..3608189 (+) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  LT232_RS17905 (LT232_17905) - 3608196..3608537 (-) 342 WP_007408677.1 hypothetical protein -
  LT232_RS17910 (LT232_17910) degQ 3609000..3609140 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  LT232_RS17915 (LT232_17915) - 3609348..3610208 (+) 861 WP_157774448.1 polyprenyl synthetase family protein -
  LT232_RS17920 (LT232_17920) comX 3610177..3610350 (+) 174 WP_012118314.1 competence pheromone ComX -
  LT232_RS17925 (LT232_17925) - 3610364..3612663 (+) 2300 Protein_3507 sensor histidine kinase -
  LT232_RS17930 (LT232_17930) comA 3612744..3613388 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  LT232_RS17935 (LT232_17935) - 3613410..3613793 (+) 384 WP_012118312.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=636189 LT232_RS17910 WP_003152043.1 3609000..3609140(+) (degQ) [Bacillus velezensis strain GSBZ09]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=636189 LT232_RS17910 WP_003152043.1 3609000..3609140(+) (degQ) [Bacillus velezensis strain GSBZ09]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891