Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | LT232_RS17910 | Genome accession | NZ_CP089287 |
| Coordinates | 3609000..3609140 (+) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain GSBZ09 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3604000..3614140
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LT232_RS17885 (LT232_17885) | - | 3604306..3604704 (+) | 399 | WP_015240486.1 | YueI family protein | - |
| LT232_RS17890 (LT232_17890) | - | 3604801..3605352 (+) | 552 | WP_003152033.1 | cysteine hydrolase family protein | - |
| LT232_RS17895 (LT232_17895) | - | 3605370..3606836 (+) | 1467 | WP_015418109.1 | nicotinate phosphoribosyltransferase | - |
| LT232_RS17900 (LT232_17900) | - | 3606966..3608189 (+) | 1224 | WP_007408678.1 | EAL and HDOD domain-containing protein | - |
| LT232_RS17905 (LT232_17905) | - | 3608196..3608537 (-) | 342 | WP_007408677.1 | hypothetical protein | - |
| LT232_RS17910 (LT232_17910) | degQ | 3609000..3609140 (+) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| LT232_RS17915 (LT232_17915) | - | 3609348..3610208 (+) | 861 | WP_157774448.1 | polyprenyl synthetase family protein | - |
| LT232_RS17920 (LT232_17920) | comX | 3610177..3610350 (+) | 174 | WP_012118314.1 | competence pheromone ComX | - |
| LT232_RS17925 (LT232_17925) | - | 3610364..3612663 (+) | 2300 | Protein_3507 | sensor histidine kinase | - |
| LT232_RS17930 (LT232_17930) | comA | 3612744..3613388 (+) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| LT232_RS17935 (LT232_17935) | - | 3613410..3613793 (+) | 384 | WP_012118312.1 | hotdog fold thioesterase | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=636189 LT232_RS17910 WP_003152043.1 3609000..3609140(+) (degQ) [Bacillus velezensis strain GSBZ09]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=636189 LT232_RS17910 WP_003152043.1 3609000..3609140(+) (degQ) [Bacillus velezensis strain GSBZ09]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |