Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   LRO88_RS17970 Genome accession   NZ_CP089148
Coordinates   3262189..3262329 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain NIB353     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3257189..3267329
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LRO88_RS17945 yuxO 3257466..3257846 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  LRO88_RS17950 comA 3257865..3258509 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  LRO88_RS17955 comP 3258590..3260902 (-) 2313 WP_041332996.1 sensor histidine kinase Regulator
  LRO88_RS17960 comX 3260918..3261139 (-) 222 WP_014480704.1 competence pheromone ComX -
  LRO88_RS17965 - 3261141..3262004 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  LRO88_RS17970 degQ 3262189..3262329 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  LRO88_RS17975 - 3262551..3262676 (+) 126 WP_003228793.1 hypothetical protein -
  LRO88_RS17980 - 3262791..3263159 (+) 369 WP_046381300.1 hypothetical protein -
  LRO88_RS17985 pdeH 3263135..3264364 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  LRO88_RS17990 pncB 3264501..3265973 (-) 1473 WP_159377062.1 nicotinate phosphoribosyltransferase -
  LRO88_RS17995 pncA 3265989..3266540 (-) 552 WP_038828671.1 cysteine hydrolase family protein -
  LRO88_RS18000 yueI 3266637..3267035 (-) 399 WP_032726794.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=635328 LRO88_RS17970 WP_003220708.1 3262189..3262329(-) (degQ) [Bacillus subtilis strain NIB353]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=635328 LRO88_RS17970 WP_003220708.1 3262189..3262329(-) (degQ) [Bacillus subtilis strain NIB353]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1