Detailed information NTG0000634

Experimentally validated

Overview

• Name: disA
• Type: Machinery gene
• Locus tag: BSU_00880
• Genome accession: NC_000964
• Coordinates: 107476..108558 (+)
• Length: 360 a.a.
• NCBI ID: NP_387969.1
• Uniprot ID: P37573
• Organism: Bacillus subtilis subsp. subtilis str. 168
• Function: homologous recombination Homologous recombination

Function

DisA is necessary to coordinate responses to replicative stress; it could help to circumvent damaged template bases that otherwise impede fork progression. RecG-mediated fork remodeling is a genuine in vivo activity, and that DisA, as a molecular switch, limits RecG-mediated fork reversal and fork restoration. DisA and RecG might provide more time to process perturbed forks, avoiding genome breakage. DisA signals DNA structures that interfere with chromosome segregation via c-di-AMP. RuvAB or RecU pre-bound to HJ DNA strongly inhibits DisA-mediated synthesis of c-di-AMP, and indirectly blocks cell proliferation. DisA limits the ssDNA-dependent ATPase activity of RadA/Sms C13A, and inhibits the helicase activity of RadA/Sms by a protein-protein interaction. RadA/Sms inhibits DisA-mediated c-di-AMP synthesis and indirectly inhibits cell proliferation, but RecA counters this negative effect.

Genomic Context

Location: 102476..113558

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
BSU_00850 (BSU00850)	mcsB	102484..103575 (+)	1092	NP_387966.1	protein arginine kinase	-
BSU_00860 (BSU00860)	clpC	103572..106004 (+)	2433	NP_387967.1	class III stress response-related ATPase, AAA+ superfamily	Regulator
BSU_00870 (BSU00870)	radA/sms	106096..107472 (+)	1377	NP_387968.1	DNA repair protein; 6-O-methylguanine-DNA methyltransferase	Machinery gene
BSU_00880 (BSU00880)	disA	107476..108558 (+)	1083	NP_387969.1	diadenylate cyclase; DNA integrity scanning protein; cell cycle checkpoint DNA scanning protein	Machinery gene
BSU_00890 (BSU00890)	yacL	108674..109774 (+)	1101	NP_387970.1	putative membrane protein possibly involved in RNA binding	-
BSU_00900 (BSU00900)	ispD	109789..110487 (+)	699	NP_387971.1	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, nonmevalonate isoprenoid pathway	-
BSU_00910 (BSU00910)	ispF	110480..110956 (+)	477	NP_387972.1	2-C-methyl-D-erythritol-2,4-cyclodiphosphate synthase	-
BSU_00920 (BSU00920)	gltX	111047..112498 (+)	1452	NP_387973.1	glutamyl-tRNA synthetase	-
BSU_00930 (BSU00930)	cysE	112800..113453 (+)	654	NP_387974.1	serine O-acetyltransferase	-

Sequence

Protein

• Length: 360 a.a.
• Molecular weight: 40734.29 Da
• Isoelectric Point: 5.7343

>NTDB_id=634 BSU_00880 NP_387969.1 107476..108558(+) (disA) [Bacillus subtilis subsp. subtilis str. 168]
MEKEKKGAKHELDLSSILQFVAPGTPLRAGMENVLRANTGGLIVVGYNDKVKEVVDGGFHINTAFSPAHLYELAKMDGAI
ILSDSGQKILYANTQLMPDATISSSETGMRHRTAERVAKQTGCLVIAISERRNVITLYQENMKYTLKDIGFILTKANQAI
QTLEKYKTILDKTINALNALEFEELVTFSDVLSVMHRYEMVLRIKNEINMYIKELGTEGHLIKLQVIELITDMEEEAALF
IKDYVKEKIKDPFVLLKELQDMSSYDLLDDSIVYKLLGYPASTNLDDYVLPRGYRLLNKIPRLPMPIVENVVEAFGVLPR
IIEASAEELDEVEGIGEVRAQKIKKGLKRLQEKHYLDRQL

Nucleotide

• Length: 1083 bp

>NTDB_id=634 BSU_00880 NP_387969.1 107476..108558(+) (disA) [Bacillus subtilis subsp. subtilis str. 168]
ATGGAAAAAGAGAAAAAAGGGGCGAAACACGAGTTAGACCTGTCATCTATATTGCAGTTTGTTGCTCCGGGTACACCGCT
CAGAGCGGGGATGGAAAACGTCTTGAGAGCAAATACAGGCGGTCTGATTGTTGTTGGATATAATGATAAAGTAAAAGAAG
TGGTGGACGGCGGCTTTCACATAAACACGGCTTTTTCTCCGGCGCATTTATATGAGCTGGCTAAAATGGATGGAGCGATC
ATTTTAAGTGATTCTGGTCAAAAGATCCTATACGCGAATACTCAGCTGATGCCGGATGCCACAATTTCTTCATCAGAAAC
AGGAATGCGGCACAGAACTGCCGAAAGAGTAGCTAAGCAAACTGGCTGTCTTGTAATCGCCATTTCTGAAAGAAGAAATG
TCATAACGTTATATCAGGAAAACATGAAGTATACACTAAAAGACATAGGATTTATTTTAACCAAGGCGAACCAAGCCATT
CAAACACTTGAAAAATATAAGACAATCCTCGATAAAACGATTAATGCACTGAACGCGTTAGAGTTTGAGGAACTTGTTAC
CTTCAGTGATGTCTTGTCTGTCATGCATCGTTATGAAATGGTACTGAGAATCAAAAACGAAATTAATATGTATATCAAAG
AGCTGGGGACAGAAGGGCATCTGATCAAACTGCAAGTCATTGAATTGATTACGGATATGGAAGAAGAGGCCGCTTTATTT
ATTAAGGACTATGTAAAAGAAAAGATTAAAGATCCGTTTGTTCTCTTGAAGGAGCTGCAGGATATGTCCAGTTATGATCT
GCTGGATGATTCCATTGTGTATAAGCTTCTCGGTTACCCTGCTTCTACTAATCTTGATGATTATGTATTGCCGAGAGGAT
ACAGGCTGTTAAATAAGATACCGCGTCTTCCGATGCCGATTGTTGAAAATGTTGTAGAAGCATTTGGAGTCCTGCCAAGG
ATTATTGAGGCGAGTGCAGAAGAATTAGATGAAGTAGAGGGAATCGGTGAAGTACGAGCCCAAAAAATCAAAAAAGGATT
AAAACGCCTGCAAGAGAAGCATTATTTAGACAGACAACTGTGA

Domains

Predicted by InterProScan.

• DisA bacterial checkpoint controller nucleotide-binding (DAC) (29-141)

• DisA bacterial checkpoint controller linker region (DisA-linker) (146-284)

3D structure

• AlphaFold DB: P37573

References

• [1]: Alejandra Rangel-Mendoza et al. (2025) Germination and Outgrowth of Bacillus subtilis Spores Deficient in BER and DisA Unveil Alternative Genetic Checkpoints. Microorganisms 13(4):939. [PMID: 40284773]
• [2]: Rubén Torres et al. (2021) DisA Limits RecG Activities at Stalled or Reversed Replication Forks. Cells 10(6):1357. [PMID: 34073022]
• [3]: Carolina Gándara et al. (2021) DisA Restrains the Processing and Cleavage of Reversed Replication Forks by the RuvAB-RecU Resolvasome. International Journal of Molecular Sciences 22(21):11323. [PMID: 34768753]
• [4]: Rubén Torres et al. (2021) Bacillus subtilis RecA, DisA, and RadA/Sms Interplay Prevents Replication Stress by Regulating Fork Remodeling. Frontiers in Microbiology 12:766897. [PMID: 34880841]
• [5]: Luz I Valenzuela-García et al. (2018) Transcriptional coupling (Mfd) and DNA damage scanning (DisA) coordinate excision repair events for efficient Bacillus subtilis spore outgrowth. MicrobiologyOpen 7(5):e00593. [PMID: 29536659]
• [6]: Carolina Gándara et al. (2017) Activity and in vivo dynamics of Bacillus subtilis DisA are affected by RadA/Sms and by Holliday junction-processing proteins. DNA Repair 55:17-30. [PMID: 28511132]
• [7]: Marina Raguse et al. (2017) Bacillus subtilis DisA helps to circumvent replicative stress during spore revival. DNA Repair 59:57-68. [PMID: 28961460]
• [8]: Clement Opoku-Temeng et al. (2016) Inhibition of cyclic diadenylate cyclase, DisA, by polyphenols. Scientific Reports 6:25445. [PMID: 27150552]
• [9]: Carolina Gándara et al. (2015) DisA and c-di-AMP act at the intersection between DNA-damage response and stress homeostasis in exponentially growing Bacillus subtilis cells. DNA Repair 27:1-8. [PMID: 25616256]
• [10]: Silvia S Campos et al. (2014) Interaction of apurinic/apyrimidinic endonucleases Nfo and ExoA with the DNA integrity scanning protein DisA in the processing of oxidative DNA damage during Bacillus subtilis spore outgrowth. Journal of Bacteriology 196(3):568-78. [PMID: 24244006]
• [11]: Gregor Witte et al. (2008) Structural biochemistry of a bacterial checkpoint protein reveals diadenylate cyclase activity regulated by DNA recombination intermediates. Molecular Cell 30(2):167-78. [PMID: 18439896]