Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   LOC77_RS12875 Genome accession   NZ_CP087957
Coordinates   2602104..2602277 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain B-001     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2597104..2607277
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LOC77_RS12860 gcvT 2597922..2599022 (-) 1101 WP_058906182.1 glycine cleavage system aminomethyltransferase GcvT -
  LOC77_RS12865 - 2599445..2601115 (+) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  LOC77_RS12870 - 2601133..2601927 (+) 795 WP_165625717.1 YqhG family protein -
  LOC77_RS12875 sinI 2602104..2602277 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  LOC77_RS12880 sinR 2602311..2602646 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LOC77_RS12885 tasA 2602694..2603479 (-) 786 WP_015388008.1 biofilm matrix protein TasA -
  LOC77_RS12890 sipW 2603543..2604127 (-) 585 WP_230639576.1 signal peptidase I SipW -
  LOC77_RS12895 tapA 2604099..2604770 (-) 672 WP_115996533.1 amyloid fiber anchoring/assembly protein TapA -
  LOC77_RS12900 - 2605030..2605359 (+) 330 WP_230639577.1 DUF3889 domain-containing protein -
  LOC77_RS12905 - 2605399..2605578 (-) 180 WP_003153093.1 YqzE family protein -
  LOC77_RS12910 comGG 2605635..2606012 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  LOC77_RS12915 comGF 2606013..2606408 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  LOC77_RS12920 comGE 2606422..2606736 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  LOC77_RS12925 comGD 2606720..2607157 (-) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=632040 LOC77_RS12875 WP_003153105.1 2602104..2602277(+) (sinI) [Bacillus velezensis strain B-001]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=632040 LOC77_RS12875 WP_003153105.1 2602104..2602277(+) (sinI) [Bacillus velezensis strain B-001]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702