Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   LOC77_RS12920 Genome accession   NZ_CP087957
Coordinates   2606422..2606736 (-) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus velezensis strain B-001     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2601422..2611736
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LOC77_RS12875 sinI 2602104..2602277 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  LOC77_RS12880 sinR 2602311..2602646 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LOC77_RS12885 tasA 2602694..2603479 (-) 786 WP_015388008.1 biofilm matrix protein TasA -
  LOC77_RS12890 sipW 2603543..2604127 (-) 585 WP_230639576.1 signal peptidase I SipW -
  LOC77_RS12895 tapA 2604099..2604770 (-) 672 WP_115996533.1 amyloid fiber anchoring/assembly protein TapA -
  LOC77_RS12900 - 2605030..2605359 (+) 330 WP_230639577.1 DUF3889 domain-containing protein -
  LOC77_RS12905 - 2605399..2605578 (-) 180 WP_003153093.1 YqzE family protein -
  LOC77_RS12910 comGG 2605635..2606012 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  LOC77_RS12915 comGF 2606013..2606408 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  LOC77_RS12920 comGE 2606422..2606736 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  LOC77_RS12925 comGD 2606720..2607157 (-) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene
  LOC77_RS12930 comGC 2607147..2607455 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  LOC77_RS12935 comGB 2607460..2608497 (-) 1038 WP_024085602.1 competence type IV pilus assembly protein ComGB Machinery gene
  LOC77_RS12940 comGA 2608484..2609554 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  LOC77_RS12945 - 2609746..2610696 (-) 951 WP_014305415.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=632043 LOC77_RS12920 WP_015388003.1 2606422..2606736(-) (comGE) [Bacillus velezensis strain B-001]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=632043 LOC77_RS12920 WP_015388003.1 2606422..2606736(-) (comGE) [Bacillus velezensis strain B-001]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481