Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   U471_RS14360 Genome accession   NC_022653
Coordinates   2995665..2995805 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens CC178     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2990665..3000805
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  U471_RS14340 (U471_29780) - 2991011..2991394 (-) 384 WP_012118312.1 hotdog fold thioesterase -
  U471_RS14345 (U471_29790) comA 2991416..2992060 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  U471_RS14350 (U471_29800) comP 2992141..2994441 (-) 2301 WP_012118313.1 histidine kinase Regulator
  U471_RS19480 (U471_29810) comX 2994455..2994628 (-) 174 WP_012118314.1 competence pheromone ComX -
  U471_RS14355 (U471_29820) - 2994597..2995457 (-) 861 WP_012118315.1 polyprenyl synthetase family protein -
  U471_RS14360 (U471_29830) degQ 2995665..2995805 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  U471_RS14365 (U471_29840) - 2996270..2996611 (+) 342 WP_012118316.1 hypothetical protein -
  U471_RS14370 (U471_29860) - 2996618..2997841 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  U471_RS14375 (U471_29870) - 2997971..2999437 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  U471_RS14380 (U471_29880) - 2999455..3000006 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  U471_RS14385 (U471_29890) - 3000103..3000501 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=63190 U471_RS14360 WP_003152043.1 2995665..2995805(-) (degQ) [Bacillus amyloliquefaciens CC178]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=63190 U471_RS14360 WP_003152043.1 2995665..2995805(-) (degQ) [Bacillus amyloliquefaciens CC178]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment