Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BAPNAU_RS06770 | Genome accession | NC_022530 |
| Coordinates | 1348619..1348792 (-) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis NAU-B3 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1343619..1353792
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BAPNAU_RS06720 (BAPNAU_1280) | comGD | 1343738..1344175 (+) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| BAPNAU_RS06725 (BAPNAU_1281) | comGE | 1344159..1344473 (+) | 315 | WP_021494312.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| BAPNAU_RS06730 (BAPNAU_1282) | comGF | 1344487..1344882 (+) | 396 | WP_046559876.1 | competence type IV pilus minor pilin ComGF | - |
| BAPNAU_RS06735 (BAPNAU_1283) | comGG | 1344883..1345260 (+) | 378 | WP_022552965.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| BAPNAU_RS06740 (BAPNAU_1284) | - | 1345317..1345496 (+) | 180 | WP_022552966.1 | YqzE family protein | - |
| BAPNAU_RS06745 (BAPNAU_1285) | - | 1345537..1345866 (-) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| BAPNAU_RS06750 (BAPNAU_1286) | tapA | 1346125..1346796 (+) | 672 | WP_014418371.1 | amyloid fiber anchoring/assembly protein TapA | - |
| BAPNAU_RS06755 (BAPNAU_1287) | - | 1346768..1347352 (+) | 585 | WP_022552967.1 | signal peptidase I | - |
| BAPNAU_RS06760 (BAPNAU_1288) | - | 1347417..1348202 (+) | 786 | WP_007408329.1 | TasA family protein | - |
| BAPNAU_RS06765 (BAPNAU_1289) | sinR | 1348250..1348585 (-) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| BAPNAU_RS06770 (BAPNAU_1290) | sinI | 1348619..1348792 (-) | 174 | WP_014418369.1 | anti-repressor SinI family protein | Regulator |
| BAPNAU_RS06775 (BAPNAU_1291) | - | 1348969..1349763 (-) | 795 | WP_014418368.1 | YqhG family protein | - |
| BAPNAU_RS06780 (BAPNAU_1292) | - | 1349785..1351455 (-) | 1671 | WP_038461530.1 | SNF2-related protein | - |
| BAPNAU_RS06785 (BAPNAU_1293) | gcvT | 1351879..1352979 (+) | 1101 | WP_017418134.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=62657 BAPNAU_RS06770 WP_014418369.1 1348619..1348792(-) (sinI) [Bacillus velezensis NAU-B3]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=62657 BAPNAU_RS06770 WP_014418369.1 1348619..1348792(-) (sinI) [Bacillus velezensis NAU-B3]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |