Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   LNB41_RS04900 Genome accession   NZ_CP086592
Coordinates   992949..993476 (+) Length   175 a.a.
NCBI ID   WP_010716891.1    Uniprot ID   -
Organism   Enterococcus faecalis strain Fac74     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 982285..1021979 992949..993476 within 0


Gene organization within MGE regions


Location: 982285..1021979
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LNB41_RS04815 (LNB41_04815) - 982285..983421 (-) 1137 WP_010712197.1 site-specific integrase -
  LNB41_RS04820 (LNB41_04820) - 983546..984130 (-) 585 WP_010823488.1 DUF4352 domain-containing protein -
  LNB41_RS04825 (LNB41_04825) - 984212..984469 (-) 258 Protein_941 toxin -
  LNB41_RS04830 (LNB41_04830) - 984497..985234 (-) 738 WP_104845043.1 DUF4950 domain-containing protein -
  LNB41_RS04835 (LNB41_04835) - 985256..985894 (-) 639 WP_010716880.1 ImmA/IrrE family metallo-endopeptidase -
  LNB41_RS04840 (LNB41_04840) - 985909..986250 (-) 342 WP_010716881.1 helix-turn-helix domain-containing protein -
  LNB41_RS04845 (LNB41_04845) - 986495..987454 (+) 960 WP_002360751.1 IS30-like element IS1062 family transposase -
  LNB41_RS04850 (LNB41_04850) - 987635..987811 (+) 177 WP_010716882.1 helix-turn-helix transcriptional regulator -
  LNB41_RS04855 (LNB41_04855) - 987825..988163 (+) 339 WP_010716883.1 DUF771 domain-containing protein -
  LNB41_RS04860 (LNB41_04860) - 988166..988879 (+) 714 WP_104670706.1 Rha family transcriptional regulator -
  LNB41_RS04865 (LNB41_04865) - 988890..989075 (+) 186 WP_002364665.1 hypothetical protein -
  LNB41_RS04870 (LNB41_04870) - 989087..989260 (+) 174 WP_010716885.1 hypothetical protein -
  LNB41_RS04875 (LNB41_04875) - 989461..990204 (+) 744 WP_010716887.1 ERF family protein -
  LNB41_RS04880 (LNB41_04880) - 990204..991142 (+) 939 WP_010716888.1 DUF1351 domain-containing protein -
  LNB41_RS04885 (LNB41_04885) - 991139..991780 (+) 642 WP_021732904.1 putative HNHc nuclease -
  LNB41_RS04890 (LNB41_04890) - 991800..992651 (+) 852 WP_029657338.1 hypothetical protein -
  LNB41_RS04895 (LNB41_04895) - 992651..992959 (+) 309 WP_002381633.1 MazG-like family protein -
  LNB41_RS04900 (LNB41_04900) ssb 992949..993476 (+) 528 WP_010716891.1 single-stranded DNA-binding protein Machinery gene
  LNB41_RS04905 (LNB41_04905) - 993488..993817 (+) 330 WP_002381635.1 hypothetical protein -
  LNB41_RS04910 (LNB41_04910) - 993837..994043 (+) 207 WP_002395701.1 hypothetical protein -
  LNB41_RS04915 (LNB41_04915) - 994140..994841 (+) 702 WP_229023964.1 DNA-methyltransferase -
  LNB41_RS04920 (LNB41_04920) - 994944..995150 (+) 207 WP_002395701.1 hypothetical protein -
  LNB41_RS04925 (LNB41_04925) - 995247..995987 (+) 741 WP_202580005.1 DNA-methyltransferase -
  LNB41_RS04930 (LNB41_04930) - 996010..996222 (-) 213 WP_010730059.1 hypothetical protein -
  LNB41_RS04935 (LNB41_04935) - 996306..996752 (+) 447 WP_104670707.1 YopX family protein -
  LNB41_RS04940 (LNB41_04940) - 996749..997108 (+) 360 WP_010716895.1 hypothetical protein -
  LNB41_RS04945 (LNB41_04945) - 997105..997407 (+) 303 WP_002393229.1 hypothetical protein -
  LNB41_RS04950 (LNB41_04950) - 997419..997586 (+) 168 WP_002405636.1 hypothetical protein -
  LNB41_RS04955 (LNB41_04955) - 997579..998127 (+) 549 WP_104670708.1 DUF1642 domain-containing protein -
  LNB41_RS04960 (LNB41_04960) - 998127..998558 (+) 432 WP_010716897.1 ASCH/PUA domain-containing protein -
  LNB41_RS04965 (LNB41_04965) - 998572..998889 (+) 318 WP_010716898.1 hypothetical protein -
  LNB41_RS04970 (LNB41_04970) - 998883..999095 (+) 213 WP_010716899.1 hypothetical protein -
  LNB41_RS04975 (LNB41_04975) - 999096..999515 (+) 420 WP_010716900.1 RinA family phage transcriptional regulator -
  LNB41_RS04980 (LNB41_04980) - 999789..1000538 (+) 750 WP_010716901.1 hypothetical protein -
  LNB41_RS04985 (LNB41_04985) - 1000572..1001108 (+) 537 WP_010716902.1 hypothetical protein -
  LNB41_RS04990 (LNB41_04990) terS 1001161..1001964 (+) 804 WP_010716903.1 phage terminase small subunit -
  LNB41_RS04995 (LNB41_04995) - 1001936..1003225 (+) 1290 WP_025191956.1 PBSX family phage terminase large subunit -
  LNB41_RS05000 (LNB41_05000) - 1003238..1004713 (+) 1476 WP_010716904.1 phage portal protein -
  LNB41_RS05005 (LNB41_05005) - 1004688..1005734 (+) 1047 WP_010716905.1 SPP1 gp7 family phage head morphogenesis protein -
  LNB41_RS05010 (LNB41_05010) - 1005737..1006057 (+) 321 WP_010716906.1 hypothetical protein -
  LNB41_RS05015 (LNB41_05015) - 1006276..1006905 (+) 630 WP_229023965.1 DUF4355 domain-containing protein -
  LNB41_RS05020 (LNB41_05020) - 1006919..1007821 (+) 903 WP_104670709.1 DUF5309 family protein -
  LNB41_RS05025 (LNB41_05025) - 1007845..1008081 (+) 237 WP_002404933.1 hypothetical protein -
  LNB41_RS05030 (LNB41_05030) - 1008090..1008434 (+) 345 WP_002395886.1 hypothetical protein -
  LNB41_RS05035 (LNB41_05035) - 1008431..1008808 (+) 378 WP_002404932.1 hypothetical protein -
  LNB41_RS05040 (LNB41_05040) - 1008801..1009199 (+) 399 WP_002402415.1 HK97 gp10 family phage protein -
  LNB41_RS05045 (LNB41_05045) - 1009203..1009577 (+) 375 WP_104670710.1 DUF6838 family protein -
  LNB41_RS05050 (LNB41_05050) - 1009578..1010420 (+) 843 WP_100966702.1 major tail protein -
  LNB41_RS05055 (LNB41_05055) gpG 1010473..1010826 (+) 354 WP_002364485.1 phage tail assembly chaperone G -
  LNB41_RS05060 (LNB41_05060) - 1011075..1013972 (+) 2898 WP_181033979.1 tape measure protein -
  LNB41_RS05065 (LNB41_05065) - 1013962..1014696 (+) 735 WP_104670712.1 phage tail protein -
  LNB41_RS05070 (LNB41_05070) - 1014678..1017392 (+) 2715 WP_181033978.1 phage tail spike protein -
  LNB41_RS05075 (LNB41_05075) - 1017408..1018289 (+) 882 WP_104670714.1 phage baseplate upper protein -
  LNB41_RS05080 (LNB41_05080) - 1018282..1018878 (+) 597 WP_025192304.1 hypothetical protein -
  LNB41_RS05085 (LNB41_05085) - 1018875..1019162 (+) 288 WP_002365086.1 collagen-like protein -
  LNB41_RS05090 (LNB41_05090) - 1019162..1019671 (+) 510 WP_010716870.1 hypothetical protein -
  LNB41_RS05095 (LNB41_05095) - 1019688..1020062 (+) 375 WP_002402192.1 hypothetical protein -
  LNB41_RS05100 (LNB41_05100) - 1020062..1020199 (+) 138 WP_002399193.1 XkdX family protein -
  LNB41_RS05105 (LNB41_05105) - 1020233..1020466 (+) 234 WP_002383824.1 hemolysin XhlA family protein -
  LNB41_RS05110 (LNB41_05110) - 1020469..1020675 (+) 207 WP_010784051.1 phage holin -
  LNB41_RS05115 (LNB41_05115) - 1020678..1021979 (+) 1302 WP_010828322.1 LysM peptidoglycan-binding domain-containing protein -

Sequence


Protein


Download         Length: 175 a.a.        Molecular weight: 19296.09 Da        Isoelectric Point: 4.7051

>NTDB_id=625619 LNB41_RS04900 WP_010716891.1 992949..993476(+) (ssb) [Enterococcus faecalis strain Fac74]
MINNVVLVGRLTKDPDLRYTASGSAVGSFTLAVNRNFTNQNGEREADFINCVIWHKPAETMANYARKGTLLGVVGRIQTR
NYDNQQGQRVYVTEVVCESFQLLESKSTNENRNSVQSSQNSVTGVQNNFESNYATNQNKGLNQQNNSQQMSFGGDVDPFA
GAGNSIDISDDDLPF

Nucleotide


Download         Length: 528 bp        

>NTDB_id=625619 LNB41_RS04900 WP_010716891.1 992949..993476(+) (ssb) [Enterococcus faecalis strain Fac74]
ATGATAAATAATGTGGTATTAGTCGGAAGATTGACAAAAGATCCTGATTTACGCTACACCGCCAGTGGTTCTGCAGTTGG
AAGCTTTACTCTTGCTGTGAACCGTAACTTTACAAACCAAAATGGCGAACGAGAAGCGGATTTTATCAACTGTGTAATTT
GGCATAAGCCTGCTGAAACAATGGCTAATTATGCTCGTAAAGGAACATTATTAGGAGTTGTTGGCAGAATTCAAACTCGT
AATTATGACAACCAACAAGGCCAACGTGTCTATGTGACTGAAGTTGTTTGCGAGAGTTTCCAATTATTAGAGTCAAAAAG
CACCAATGAGAATAGAAATAGCGTTCAGAGTTCGCAGAATAGCGTTACAGGCGTTCAAAATAATTTCGAGAGTAATTATG
CCACGAATCAAAACAAAGGCTTAAATCAGCAAAATAACAGCCAACAAATGTCGTTTGGTGGAGATGTAGATCCGTTCGCA
GGTGCAGGTAATTCAATCGACATTAGCGATGATGATCTGCCTTTTTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

59.551

100

0.606

  ssbA Bacillus subtilis subsp. subtilis str. 168

58.427

100

0.594