Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   FNL60_RS08370 Genome accession   NZ_AP019720
Coordinates   1654626..1654856 (-) Length   76 a.a.
NCBI ID   WP_002275977.1    Uniprot ID   Q8DVP7
Organism   Streptococcus mutans strain NBRC 13955     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 1649626..1659856
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FNL60_RS08345 (SM3g_15510) - 1649687..1650178 (+) 492 WP_018110171.1 YgjV family protein -
  FNL60_RS08350 (SM3g_15520) - 1650284..1651105 (-) 822 WP_032506494.1 Cof-type HAD-IIB family hydrolase -
  FNL60_RS08355 (SM3g_15530) copZ 1651351..1651554 (-) 204 WP_002264873.1 copper chaperone CopZ -
  FNL60_RS08360 (SM3g_15540) - 1651567..1653795 (-) 2229 WP_002267008.1 heavy metal translocating P-type ATPase -
  FNL60_RS08365 (SM3g_15550) - 1653792..1654235 (-) 444 WP_002267007.1 CopY/TcrY family copper transport repressor -
  FNL60_RS08370 (SM3g_15560) cipB 1654626..1654856 (-) 231 WP_002275977.1 bacteriocin class II family protein Regulator
  FNL60_RS08375 (SM3g_15580) rbfA 1655335..1655685 (-) 351 WP_002262599.1 30S ribosome-binding factor RbfA -
  FNL60_RS08380 (SM3g_15590) infB 1655919..1658141 (-) 2223 Protein_1572 translation initiation factor IF-2 -
  FNL60_RS10655 - 1658574..1658669 (-) 96 Protein_1573 translation initiation factor IF-2 N-terminal domain-containing protein -
  FNL60_RS08385 (SM3g_15600) - 1658690..1658992 (-) 303 WP_002262601.1 YlxQ-related RNA-binding protein -
  FNL60_RS08390 (SM3g_15610) rnpM 1658985..1659281 (-) 297 WP_002263922.1 RNase P modulator RnpM -

Sequence

Protein


Download         Length: 76 a.a.        Molecular weight: 7229.19 Da        Isoelectric Point: 3.7781

>NTDB_id=62523 FNL60_RS08370 WP_002275977.1 1654626..1654856(-) (cipB) [Streptococcus mutans strain NBRC 13955]
MNTQAFEQFNVMDNEALSTVEGGGMIRCALGTAGSAGLGFVGGMGAGTVTLPVVGTVSGAALGGWSGAAVGAATFC

Nucleotide


Download         Length: 231 bp        

>NTDB_id=62523 FNL60_RS08370 WP_002275977.1 1654626..1654856(-) (cipB) [Streptococcus mutans strain NBRC 13955]
ATGAATACACAAGCATTTGAACAATTTAACGTAATGGATAATGAAGCACTTTCAACTGTTGAGGGTGGTGGTATGATTAG
ATGTGCACTTGGCACAGCTGGTTCTGCAGGTTTAGGATTTGTAGGGGGTATGGGAGCTGGTACAGTTACTCTCCCAGTCG
TTGGTACAGTATCTGGAGCGGCTTTAGGAGGCTGGTCTGGAGCAGCTGTAGGTGCTGCTACTTTTTGTTGA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-70)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q8DVP7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

71.429

55.263

0.395

Multiple sequence alignment