Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGF   Type   Machinery gene
Locus tag   LJC78_RS12790 Genome accession   NZ_CP086007
Coordinates   2375228..2375611 (-) Length   127 a.a.
NCBI ID   WP_014480254.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. natto strain SCP010-1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2370228..2380611
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LJC78_RS12750 (LJC78_12755) sinI 2371162..2371335 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  LJC78_RS12755 (LJC78_12760) sinR 2371369..2371704 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  LJC78_RS12760 (LJC78_12765) tasA 2371797..2372582 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  LJC78_RS12765 (LJC78_12770) sipW 2372646..2373218 (-) 573 WP_003230181.1 signal peptidase I SipW -
  LJC78_RS12770 (LJC78_12775) tapA 2373202..2373963 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  LJC78_RS12775 (LJC78_12780) yqzG 2374235..2374561 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  LJC78_RS12780 (LJC78_12785) spoIITA 2374603..2374782 (-) 180 WP_014480252.1 YqzE family protein -
  LJC78_RS12785 (LJC78_12790) comGG 2374853..2375227 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  LJC78_RS12790 (LJC78_12795) comGF 2375228..2375611 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  LJC78_RS12795 (LJC78_12800) comGE 2375637..2375984 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  LJC78_RS12800 (LJC78_12805) comGD 2375968..2376399 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  LJC78_RS12805 (LJC78_12810) comGC 2376389..2376685 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  LJC78_RS12810 (LJC78_12815) comGB 2376699..2377736 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  LJC78_RS12815 (LJC78_12820) comGA 2377723..2378793 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  LJC78_RS12820 (LJC78_12825) - 2379005..2379202 (-) 198 WP_014480259.1 CBS domain-containing protein -
  LJC78_RS12825 (LJC78_12830) corA 2379204..2380157 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 127 a.a.        Molecular weight: 14329.42 Da        Isoelectric Point: 5.8949

>NTDB_id=621974 LJC78_RS12790 WP_014480254.1 2375228..2375611(-) (comGF) [Bacillus subtilis subsp. natto strain SCP010-1]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=621974 LJC78_RS12790 WP_014480254.1 2375228..2375611(-) (comGF) [Bacillus subtilis subsp. natto strain SCP010-1]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA

Domains

Predicted by InterproScan.

Putative Competence protein ComGF (ComGF)

(16-114)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984