Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   LJC78_RS12750 Genome accession   NZ_CP086007
Coordinates   2371162..2371335 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis subsp. natto strain SCP010-1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2366162..2376335
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LJC78_RS12735 (LJC78_12740) gcvT 2366961..2368049 (-) 1089 WP_014480247.1 glycine cleavage system aminomethyltransferase GcvT -
  LJC78_RS12740 (LJC78_12745) hepAA 2368491..2370164 (+) 1674 WP_014480248.1 DEAD/DEAH box helicase -
  LJC78_RS12745 (LJC78_12750) yqhG 2370185..2370979 (+) 795 WP_014480249.1 YqhG family protein -
  LJC78_RS12750 (LJC78_12755) sinI 2371162..2371335 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  LJC78_RS12755 (LJC78_12760) sinR 2371369..2371704 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  LJC78_RS12760 (LJC78_12765) tasA 2371797..2372582 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  LJC78_RS12765 (LJC78_12770) sipW 2372646..2373218 (-) 573 WP_003230181.1 signal peptidase I SipW -
  LJC78_RS12770 (LJC78_12775) tapA 2373202..2373963 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  LJC78_RS12775 (LJC78_12780) yqzG 2374235..2374561 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  LJC78_RS12780 (LJC78_12785) spoIITA 2374603..2374782 (-) 180 WP_014480252.1 YqzE family protein -
  LJC78_RS12785 (LJC78_12790) comGG 2374853..2375227 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  LJC78_RS12790 (LJC78_12795) comGF 2375228..2375611 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  LJC78_RS12795 (LJC78_12800) comGE 2375637..2375984 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=621971 LJC78_RS12750 WP_003230187.1 2371162..2371335(+) (sinI) [Bacillus subtilis subsp. natto strain SCP010-1]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=621971 LJC78_RS12750 WP_003230187.1 2371162..2371335(+) (sinI) [Bacillus subtilis subsp. natto strain SCP010-1]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1