Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   NUW85_RS16225 Genome accession   NZ_CP102603
Coordinates   3320056..3320196 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain MBLB0692     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3315056..3325196
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NUW85_RS16200 (NUW85_16205) - 3315362..3315760 (+) 399 WP_003152031.1 DUF1694 domain-containing protein -
  NUW85_RS16205 (NUW85_16210) - 3315857..3316408 (+) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  NUW85_RS16210 (NUW85_16215) - 3316426..3317892 (+) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  NUW85_RS16215 (NUW85_16220) - 3318022..3319242 (+) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  NUW85_RS16220 (NUW85_16225) - 3319249..3319590 (-) 342 WP_014305721.1 hypothetical protein -
  NUW85_RS16225 (NUW85_16230) degQ 3320056..3320196 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  NUW85_RS16230 (NUW85_16235) comQ 3320381..3321259 (+) 879 WP_024085740.1 polyprenyl synthetase family protein Regulator
  NUW85_RS16235 (NUW85_16240) comX 3321259..3321423 (+) 165 WP_007613432.1 competence pheromone ComX -
  NUW85_RS16240 (NUW85_16245) comP 3321435..3323726 (+) 2292 WP_014305719.1 histidine kinase Regulator
  NUW85_RS16245 (NUW85_16250) comA 3323807..3324451 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  NUW85_RS16250 (NUW85_16255) - 3324473..3324856 (+) 384 WP_139885447.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=617480 NUW85_RS16225 WP_003152043.1 3320056..3320196(+) (degQ) [Bacillus amyloliquefaciens strain MBLB0692]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=617480 NUW85_RS16225 WP_003152043.1 3320056..3320196(+) (degQ) [Bacillus amyloliquefaciens strain MBLB0692]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891