Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | NUW85_RS16225 | Genome accession | NZ_CP102603 |
| Coordinates | 3320056..3320196 (+) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus amyloliquefaciens strain MBLB0692 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3315056..3325196
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUW85_RS16200 (NUW85_16205) | - | 3315362..3315760 (+) | 399 | WP_003152031.1 | DUF1694 domain-containing protein | - |
| NUW85_RS16205 (NUW85_16210) | - | 3315857..3316408 (+) | 552 | WP_003152033.1 | isochorismatase family cysteine hydrolase | - |
| NUW85_RS16210 (NUW85_16215) | - | 3316426..3317892 (+) | 1467 | WP_014305722.1 | nicotinate phosphoribosyltransferase | - |
| NUW85_RS16215 (NUW85_16220) | - | 3318022..3319242 (+) | 1221 | WP_003152038.1 | EAL and HDOD domain-containing protein | - |
| NUW85_RS16220 (NUW85_16225) | - | 3319249..3319590 (-) | 342 | WP_014305721.1 | hypothetical protein | - |
| NUW85_RS16225 (NUW85_16230) | degQ | 3320056..3320196 (+) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| NUW85_RS16230 (NUW85_16235) | comQ | 3320381..3321259 (+) | 879 | WP_024085740.1 | polyprenyl synthetase family protein | Regulator |
| NUW85_RS16235 (NUW85_16240) | comX | 3321259..3321423 (+) | 165 | WP_007613432.1 | competence pheromone ComX | - |
| NUW85_RS16240 (NUW85_16245) | comP | 3321435..3323726 (+) | 2292 | WP_014305719.1 | histidine kinase | Regulator |
| NUW85_RS16245 (NUW85_16250) | comA | 3323807..3324451 (+) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| NUW85_RS16250 (NUW85_16255) | - | 3324473..3324856 (+) | 384 | WP_139885447.1 | hotdog fold thioesterase | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=617480 NUW85_RS16225 WP_003152043.1 3320056..3320196(+) (degQ) [Bacillus amyloliquefaciens strain MBLB0692]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=617480 NUW85_RS16225 WP_003152043.1 3320056..3320196(+) (degQ) [Bacillus amyloliquefaciens strain MBLB0692]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |