Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   LIS75_RS11905 Genome accession   NZ_CP085388
Coordinates   2460199..2460636 (-) Length   145 a.a.
NCBI ID   WP_015388002.1    Uniprot ID   -
Organism   Bacillus velezensis strain CMF18     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2455199..2465636
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LIS75_RS11855 (LIS75_11865) sinI 2455583..2455756 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  LIS75_RS11860 (LIS75_11870) sinR 2455790..2456125 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LIS75_RS11865 (LIS75_11875) tasA 2456173..2456958 (-) 786 WP_015388008.1 biofilm matrix protein TasA -
  LIS75_RS11870 (LIS75_11880) sipW 2457022..2457606 (-) 585 WP_012117977.1 signal peptidase I SipW -
  LIS75_RS11875 (LIS75_11885) tapA 2457578..2458249 (-) 672 WP_015388007.1 amyloid fiber anchoring/assembly protein TapA -
  LIS75_RS11880 (LIS75_11890) - 2458509..2458838 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  LIS75_RS11885 (LIS75_11895) - 2458878..2459057 (-) 180 WP_003153093.1 YqzE family protein -
  LIS75_RS11890 (LIS75_11900) comGG 2459114..2459491 (-) 378 WP_015388005.1 competence type IV pilus minor pilin ComGG Machinery gene
  LIS75_RS11895 (LIS75_11905) comGF 2459492..2459887 (-) 396 WP_015388004.1 competence type IV pilus minor pilin ComGF -
  LIS75_RS11900 (LIS75_11910) comGE 2459901..2460215 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  LIS75_RS11905 (LIS75_11915) comGD 2460199..2460636 (-) 438 WP_015388002.1 competence type IV pilus minor pilin ComGD Machinery gene
  LIS75_RS11910 (LIS75_11920) comGC 2460626..2460934 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  LIS75_RS11915 (LIS75_11925) comGB 2460939..2461976 (-) 1038 WP_014305414.1 competence type IV pilus assembly protein ComGB Machinery gene
  LIS75_RS11920 (LIS75_11930) comGA 2461963..2463033 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  LIS75_RS11925 (LIS75_11935) - 2463225..2464175 (-) 951 WP_014305415.1 magnesium transporter CorA family protein -
  LIS75_RS11930 (LIS75_11940) - 2464321..2465622 (+) 1302 WP_014305416.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16328.84 Da        Isoelectric Point: 10.3354

>NTDB_id=617285 LIS75_RS11905 WP_015388002.1 2460199..2460636(-) (comGD) [Bacillus velezensis strain CMF18]
MNNNRRTENGFTLLESLVVLSLTSVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSSGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIRLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=617285 LIS75_RS11905 WP_015388002.1 2460199..2460636(-) (comGD) [Bacillus velezensis strain CMF18]
TTGAACAATAACAGGCGGACAGAAAACGGGTTTACCCTTCTTGAAAGCCTGGTTGTGTTAAGTCTGACGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTTCAAAAAGATA
TTCAGCTTGCGCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAAGCGGTAGGATTGTCGAGCGTTCTTTTGATTCACTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCGATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

54.795

100

0.552