Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   LIS75_RS11855 Genome accession   NZ_CP085388
Coordinates   2455583..2455756 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain CMF18     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2450583..2460756
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LIS75_RS11840 (LIS75_11850) gcvT 2451401..2452501 (-) 1101 WP_015388009.1 glycine cleavage system aminomethyltransferase GcvT -
  LIS75_RS11845 (LIS75_11855) - 2452924..2454594 (+) 1671 WP_003153107.1 SNF2-related protein -
  LIS75_RS11850 (LIS75_11860) - 2454612..2455406 (+) 795 WP_014305407.1 YqhG family protein -
  LIS75_RS11855 (LIS75_11865) sinI 2455583..2455756 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  LIS75_RS11860 (LIS75_11870) sinR 2455790..2456125 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LIS75_RS11865 (LIS75_11875) tasA 2456173..2456958 (-) 786 WP_015388008.1 biofilm matrix protein TasA -
  LIS75_RS11870 (LIS75_11880) sipW 2457022..2457606 (-) 585 WP_012117977.1 signal peptidase I SipW -
  LIS75_RS11875 (LIS75_11885) tapA 2457578..2458249 (-) 672 WP_015388007.1 amyloid fiber anchoring/assembly protein TapA -
  LIS75_RS11880 (LIS75_11890) - 2458509..2458838 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  LIS75_RS11885 (LIS75_11895) - 2458878..2459057 (-) 180 WP_003153093.1 YqzE family protein -
  LIS75_RS11890 (LIS75_11900) comGG 2459114..2459491 (-) 378 WP_015388005.1 competence type IV pilus minor pilin ComGG Machinery gene
  LIS75_RS11895 (LIS75_11905) comGF 2459492..2459887 (-) 396 WP_015388004.1 competence type IV pilus minor pilin ComGF -
  LIS75_RS11900 (LIS75_11910) comGE 2459901..2460215 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  LIS75_RS11905 (LIS75_11915) comGD 2460199..2460636 (-) 438 WP_015388002.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=617281 LIS75_RS11855 WP_003153105.1 2455583..2455756(+) (sinI) [Bacillus velezensis strain CMF18]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=617281 LIS75_RS11855 WP_003153105.1 2455583..2455756(+) (sinI) [Bacillus velezensis strain CMF18]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702