Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   LIT97_RS10945 Genome accession   NZ_CP085294
Coordinates   2306218..2306745 (-) Length   175 a.a.
NCBI ID   WP_010776361.1    Uniprot ID   -
Organism   Enterococcus faecalis strain EFS108     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2271392..2321766 2306218..2306745 within 0


Gene organization within MGE regions


Location: 2271392..2321766
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LIT97_RS10720 (LIT97_10720) - 2271392..2271835 (+) 444 WP_002356885.1 flavodoxin -
  LIT97_RS10725 (LIT97_10725) - 2271909..2272382 (-) 474 WP_002356884.1 TspO/MBR family protein -
  LIT97_RS10730 (LIT97_10730) - 2272540..2273112 (-) 573 WP_227297448.1 TetR/AcrR family transcriptional regulator -
  LIT97_RS10735 (LIT97_10735) - 2273363..2274601 (+) 1239 WP_002356882.1 aminopeptidase -
  LIT97_RS10740 (LIT97_10740) - 2274859..2275239 (+) 381 WP_002356881.1 PH domain-containing protein -
  LIT97_RS10745 (LIT97_10745) - 2275573..2275821 (+) 249 WP_002404980.1 hypothetical protein -
  LIT97_RS10750 (LIT97_10750) - 2275917..2276879 (-) 963 WP_002404979.1 Abi family protein -
  LIT97_RS10760 (LIT97_10760) - 2277143..2277532 (-) 390 WP_002410143.1 MAG6450 family protein -
  LIT97_RS10765 (LIT97_10765) - 2277536..2277991 (-) 456 WP_002410142.1 Panacea domain-containing protein -
  LIT97_RS10770 (LIT97_10770) - 2278248..2279507 (-) 1260 WP_227297450.1 LysM peptidoglycan-binding domain-containing protein -
  LIT97_RS10775 (LIT97_10775) - 2279512..2279715 (-) 204 WP_002369080.1 phage holin -
  LIT97_RS10780 (LIT97_10780) - 2279712..2279939 (-) 228 WP_002381665.1 hypothetical protein -
  LIT97_RS10785 (LIT97_10785) - 2280031..2282415 (-) 2385 WP_010776349.1 glycerophosphodiester phosphodiesterase family protein -
  LIT97_RS10790 (LIT97_10790) - 2282427..2282600 (-) 174 WP_002404974.1 hypothetical protein -
  LIT97_RS10795 (LIT97_10795) - 2282601..2284619 (-) 2019 WP_002404973.1 phage tail protein -
  LIT97_RS10800 (LIT97_10800) - 2284636..2285565 (-) 930 WP_002373078.1 distal tail protein Dit -
  LIT97_RS10805 (LIT97_10805) - 2285566..2288973 (-) 3408 WP_010776350.1 tape measure protein -
  LIT97_RS10810 (LIT97_10810) - 2288989..2289246 (-) 258 WP_002404971.1 hypothetical protein -
  LIT97_RS10815 (LIT97_10815) - 2289339..2289689 (-) 351 WP_002404970.1 tail assembly chaperone -
  LIT97_RS10820 (LIT97_10820) - 2289745..2290203 (-) 459 WP_002404969.1 hypothetical protein -
  LIT97_RS10825 (LIT97_10825) - 2290281..2290811 (-) 531 WP_002404968.1 phage major tail protein, TP901-1 family -
  LIT97_RS10830 (LIT97_10830) - 2290827..2291216 (-) 390 WP_002404967.1 hypothetical protein -
  LIT97_RS10835 (LIT97_10835) - 2291213..2291593 (-) 381 WP_002402384.1 HK97-gp10 family putative phage morphogenesis protein -
  LIT97_RS10840 (LIT97_10840) - 2291568..2291903 (-) 336 WP_002404966.1 hypothetical protein -
  LIT97_RS10845 (LIT97_10845) - 2291900..2292232 (-) 333 WP_002404965.1 phage head-tail connector protein -
  LIT97_RS10850 (LIT97_10850) - 2292306..2293238 (-) 933 WP_002404964.1 phage major capsid protein -
  LIT97_RS10855 (LIT97_10855) - 2293251..2293850 (-) 600 WP_002404963.1 DUF4355 domain-containing protein -
  LIT97_RS10860 (LIT97_10860) - 2293973..2294236 (-) 264 WP_025188184.1 DUF6275 family protein -
  LIT97_RS10865 (LIT97_10865) - 2294331..2294600 (-) 270 WP_002404961.1 hypothetical protein -
  LIT97_RS10870 (LIT97_10870) - 2294601..2295539 (-) 939 WP_002404960.1 minor capsid protein -
  LIT97_RS10875 (LIT97_10875) - 2295544..2297082 (-) 1539 WP_002404959.1 phage portal protein -
  LIT97_RS10880 (LIT97_10880) - 2297100..2298419 (-) 1320 WP_227297586.1 PBSX family phage terminase large subunit -
  LIT97_RS10885 (LIT97_10885) terS 2298391..2299185 (-) 795 WP_141439608.1 phage terminase small subunit -
  LIT97_RS10890 (LIT97_10890) - 2299238..2299462 (-) 225 WP_002404955.1 hypothetical protein -
  LIT97_RS10900 (LIT97_10900) - 2300997..2301464 (-) 468 WP_002373959.1 ArpU family phage packaging/lysis transcriptional regulator -
  LIT97_RS10905 (LIT97_10905) - 2301649..2301873 (-) 225 WP_021164525.1 hypothetical protein -
  LIT97_RS10910 (LIT97_10910) - 2302056..2302136 (-) 81 Protein_2122 DUF1642 domain-containing protein -
  LIT97_RS10915 (LIT97_10915) - 2302220..2302618 (-) 399 WP_077932899.1 YopX family protein -
  LIT97_RS10920 (LIT97_10920) - 2302888..2303394 (-) 507 WP_010783692.1 hypothetical protein -
  LIT97_RS10925 (LIT97_10925) - 2303412..2304368 (-) 957 WP_010730060.1 site-specific integrase -
  LIT97_RS10930 (LIT97_10930) - 2304361..2305596 (-) 1236 WP_010783690.1 N-6 DNA methylase -
  LIT97_RS10935 (LIT97_10935) - 2305651..2305857 (-) 207 WP_002395701.1 hypothetical protein -
  LIT97_RS10940 (LIT97_10940) - 2305877..2306206 (-) 330 WP_002405315.1 hypothetical protein -
  LIT97_RS10945 (LIT97_10945) ssb 2306218..2306745 (-) 528 WP_010776361.1 single-stranded DNA-binding protein Machinery gene
  LIT97_RS10950 (LIT97_10950) - 2306735..2307043 (-) 309 WP_002381633.1 MazG-like family protein -
  LIT97_RS10955 (LIT97_10955) - 2307043..2308056 (-) 1014 WP_048670087.1 hypothetical protein -
  LIT97_RS10960 (LIT97_10960) - 2308075..2308755 (-) 681 WP_002404926.1 putative HNHc nuclease -
  LIT97_RS10965 (LIT97_10965) - 2308752..2309690 (-) 939 WP_002404925.1 DUF1351 domain-containing protein -
  LIT97_RS10970 (LIT97_10970) - 2309675..2310352 (-) 678 WP_002404924.1 ERF family protein -
  LIT97_RS10975 (LIT97_10975) - 2310353..2310589 (-) 237 WP_002389004.1 hypothetical protein -
  LIT97_RS10980 (LIT97_10980) - 2310646..2310801 (-) 156 WP_002395694.1 hypothetical protein -
  LIT97_RS10985 (LIT97_10985) - 2310909..2311082 (-) 174 WP_002404922.1 hypothetical protein -
  LIT97_RS10990 (LIT97_10990) - 2311104..2311352 (-) 249 WP_002389279.1 hypothetical protein -
  LIT97_RS10995 (LIT97_10995) - 2311368..2312087 (-) 720 WP_002404920.1 phage antirepressor KilAC domain-containing protein -
  LIT97_RS11000 (LIT97_11000) - 2312169..2312402 (-) 234 WP_002389146.1 DUF739 family protein -
  LIT97_RS11005 (LIT97_11005) - 2312561..2313133 (+) 573 WP_002404919.1 helix-turn-helix domain-containing protein -
  LIT97_RS11010 (LIT97_11010) - 2313108..2313623 (+) 516 WP_002404918.1 ImmA/IrrE family metallo-endopeptidase -
  LIT97_RS11015 (LIT97_11015) - 2313712..2314413 (+) 702 WP_002404917.1 DUF5067 domain-containing protein -
  LIT97_RS11020 (LIT97_11020) - 2314437..2314637 (+) 201 WP_002389192.1 hypothetical protein -
  LIT97_RS11025 (LIT97_11025) - 2314698..2315270 (+) 573 WP_010776364.1 hypothetical protein -
  LIT97_RS11030 (LIT97_11030) - 2315337..2316473 (+) 1137 WP_002405155.1 site-specific integrase -
  LIT97_RS11040 (LIT97_11040) tadA 2316667..2317188 (-) 522 WP_002394827.1 tRNA adenosine(34) deaminase TadA -
  LIT97_RS11045 (LIT97_11045) - 2317266..2318117 (+) 852 WP_002383772.1 CdaR family transcriptional regulator -
  LIT97_RS11050 (LIT97_11050) - 2318174..2319019 (+) 846 WP_002356873.1 PhzF family phenazine biosynthesis protein -
  LIT97_RS11055 (LIT97_11055) - 2319046..2319384 (-) 339 WP_002356871.1 hypothetical protein -
  LIT97_RS11060 (LIT97_11060) - 2319468..2320172 (-) 705 WP_002384290.1 zinc metallopeptidase -
  LIT97_RS11065 (LIT97_11065) - 2320371..2320724 (+) 354 WP_002387247.1 YxeA family protein -
  LIT97_RS11070 (LIT97_11070) - 2320762..2321766 (-) 1005 WP_002356866.1 nucleoid-associated protein -

Sequence

Protein


Download         Length: 175 a.a.        Molecular weight: 19345.20 Da        Isoelectric Point: 4.7078

>NTDB_id=617115 LIT97_RS10945 WP_010776361.1 2306218..2306745(-) (ssb) [Enterococcus faecalis strain EFS108]
MINNVVLIGRLTKDIDLRYTASGSAVGSFTLAVNRNFTNQNGEREADFINCVIWRKPAETMANYARKGTLLGVVGRIQTR
NYDNQQGQRVYVTEVVCESFQLLESKSTNENRNSVQSSQNSVTGVQNNFESNYATNQNKGLNQQNNSQQMSFGGDVDPFA
GAGNSIDISDDDLPF

Nucleotide


Download         Length: 528 bp        

>NTDB_id=617115 LIT97_RS10945 WP_010776361.1 2306218..2306745(-) (ssb) [Enterococcus faecalis strain EFS108]
ATGATAAATAATGTGGTATTAATCGGAAGGCTGACGAAAGATATAGATTTACGCTACACCGCAAGTGGTTCTGCAGTTGG
AAGCTTTACTCTTGCTGTGAACCGTAACTTTACAAACCAAAACGGCGAACGAGAAGCGGATTTTATCAACTGTGTAATTT
GGCGTAAGCCTGCTGAAACAATGGCTAATTATGCTCGCAAAGGAACATTATTAGGAGTTGTTGGAAGAATTCAAACTCGT
AATTATGACAACCAACAAGGCCAACGTGTGTATGTGACTGAAGTTGTTTGCGAAAGCTTCCAATTATTAGAGTCAAAAAG
CACCAATGAGAATAGAAATAGCGTTCAGAGTTCGCAGAATAGCGTTACAGGCGTTCAAAATAATTTCGAGAGTAATTATG
CCACGAATCAAAACAAAGGCTTAAATCAGCAAAATAACAGCCAACAAATGTCGTTTGGTGGAGATGTAGATCCGTTCGCA
GGTGCAGGTAATTCAATCGACATTAGCGATGATGATCTGCCTTTTTAG

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

59.551

100

0.606
  ssbA Bacillus subtilis subsp. subtilis str. 168

57.865

100

0.589