Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   LJA36_RS17370 Genome accession   NZ_CP085282
Coordinates   3574056..3574229 (-) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus amyloliquefaciens strain TPS17     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 3569056..3579229
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LJA36_RS17320 comGD 3569176..3569613 (+) 438 WP_015417817.1 competence type IV pilus minor pilin ComGD Machinery gene
  LJA36_RS17325 comGE 3569597..3569911 (+) 315 WP_031378943.1 competence type IV pilus minor pilin ComGE -
  LJA36_RS17330 comGF 3569820..3570320 (+) 501 WP_258548905.1 competence type IV pilus minor pilin ComGF -
  LJA36_RS17335 comGG 3570321..3570698 (+) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  LJA36_RS17340 - 3570755..3570934 (+) 180 WP_003153093.1 YqzE family protein -
  LJA36_RS17345 - 3570974..3571303 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  LJA36_RS17350 tapA 3571562..3572233 (+) 672 WP_015417813.1 amyloid fiber anchoring/assembly protein TapA -
  LJA36_RS17355 sipW 3572205..3572789 (+) 585 WP_015240205.1 signal peptidase I SipW -
  LJA36_RS17360 tasA 3572854..3573639 (+) 786 WP_007408329.1 biofilm matrix protein TasA -
  LJA36_RS17365 sinR 3573687..3574022 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LJA36_RS17370 sinI 3574056..3574229 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  LJA36_RS17375 - 3574406..3575200 (-) 795 WP_007408330.1 YqhG family protein -
  LJA36_RS17380 - 3575222..3576892 (-) 1671 WP_015417810.1 SNF2-related protein -
  LJA36_RS17385 gcvT 3577316..3578416 (+) 1101 WP_031378949.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=616931 LJA36_RS17370 WP_003153105.1 3574056..3574229(-) (sinI) [Bacillus amyloliquefaciens strain TPS17]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=616931 LJA36_RS17370 WP_003153105.1 3574056..3574229(-) (sinI) [Bacillus amyloliquefaciens strain TPS17]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702