Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | LJA36_RS17370 | Genome accession | NZ_CP085282 |
| Coordinates | 3574056..3574229 (-) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus amyloliquefaciens strain TPS17 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3569056..3579229
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LJA36_RS17320 | comGD | 3569176..3569613 (+) | 438 | WP_015417817.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| LJA36_RS17325 | comGE | 3569597..3569911 (+) | 315 | WP_031378943.1 | competence type IV pilus minor pilin ComGE | - |
| LJA36_RS17330 | comGF | 3569820..3570320 (+) | 501 | WP_258548905.1 | competence type IV pilus minor pilin ComGF | - |
| LJA36_RS17335 | comGG | 3570321..3570698 (+) | 378 | WP_015417814.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| LJA36_RS17340 | - | 3570755..3570934 (+) | 180 | WP_003153093.1 | YqzE family protein | - |
| LJA36_RS17345 | - | 3570974..3571303 (-) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| LJA36_RS17350 | tapA | 3571562..3572233 (+) | 672 | WP_015417813.1 | amyloid fiber anchoring/assembly protein TapA | - |
| LJA36_RS17355 | sipW | 3572205..3572789 (+) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| LJA36_RS17360 | tasA | 3572854..3573639 (+) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| LJA36_RS17365 | sinR | 3573687..3574022 (-) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| LJA36_RS17370 | sinI | 3574056..3574229 (-) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| LJA36_RS17375 | - | 3574406..3575200 (-) | 795 | WP_007408330.1 | YqhG family protein | - |
| LJA36_RS17380 | - | 3575222..3576892 (-) | 1671 | WP_015417810.1 | SNF2-related protein | - |
| LJA36_RS17385 | gcvT | 3577316..3578416 (+) | 1101 | WP_031378949.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=616931 LJA36_RS17370 WP_003153105.1 3574056..3574229(-) (sinI) [Bacillus amyloliquefaciens strain TPS17]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=616931 LJA36_RS17370 WP_003153105.1 3574056..3574229(-) (sinI) [Bacillus amyloliquefaciens strain TPS17]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |