Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   LJA36_RS17335 Genome accession   NZ_CP085282
Coordinates   3570321..3570698 (+) Length   125 a.a.
NCBI ID   WP_015417814.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain TPS17     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 3565321..3575698
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LJA36_RS17300 - 3565637..3566587 (+) 951 WP_015417820.1 magnesium transporter CorA family protein -
  LJA36_RS17305 comGA 3566780..3567849 (+) 1070 Protein_3365 competence type IV pilus ATPase ComGA -
  LJA36_RS17310 comGB 3567836..3568873 (+) 1038 WP_015417819.1 competence type IV pilus assembly protein ComGB Machinery gene
  LJA36_RS17315 comGC 3568878..3569186 (+) 309 WP_015417818.1 competence type IV pilus major pilin ComGC Machinery gene
  LJA36_RS17320 comGD 3569176..3569613 (+) 438 WP_015417817.1 competence type IV pilus minor pilin ComGD Machinery gene
  LJA36_RS17325 comGE 3569597..3569911 (+) 315 WP_031378943.1 competence type IV pilus minor pilin ComGE -
  LJA36_RS17330 comGF 3569820..3570320 (+) 501 WP_258548905.1 competence type IV pilus minor pilin ComGF -
  LJA36_RS17335 comGG 3570321..3570698 (+) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  LJA36_RS17340 - 3570755..3570934 (+) 180 WP_003153093.1 YqzE family protein -
  LJA36_RS17345 - 3570974..3571303 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  LJA36_RS17350 tapA 3571562..3572233 (+) 672 WP_015417813.1 amyloid fiber anchoring/assembly protein TapA -
  LJA36_RS17355 sipW 3572205..3572789 (+) 585 WP_015240205.1 signal peptidase I SipW -
  LJA36_RS17360 tasA 3572854..3573639 (+) 786 WP_007408329.1 biofilm matrix protein TasA -
  LJA36_RS17365 sinR 3573687..3574022 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LJA36_RS17370 sinI 3574056..3574229 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  LJA36_RS17375 - 3574406..3575200 (-) 795 WP_007408330.1 YqhG family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14167.09 Da        Isoelectric Point: 9.7165

>NTDB_id=616929 LJA36_RS17335 WP_015417814.1 3570321..3570698(+) (comGG) [Bacillus amyloliquefaciens strain TPS17]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=616929 LJA36_RS17335 WP_015417814.1 3570321..3570698(+) (comGG) [Bacillus amyloliquefaciens strain TPS17]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCAGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGTACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504