Detailed information NTG0616696

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: LG304_RS06740
• Genome accession: NZ_CP085259
• Coordinates: 1331727..1332044 (+)
• Length: 105 a.a.
• NCBI ID: WP_058611611.1
• Uniprot ID: -
• Organism: Mammaliicoccus sciuri strain ABH-485
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1326727..1337044

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LG304_RS06700 (LG304_06685)	-	1326872..1327063 (+)	192	WP_078099923.1	YqgQ family protein	-
LG304_RS06705 (LG304_06690)	-	1327060..1328031 (+)	972	WP_135016726.1	ROK family glucokinase	-
LG304_RS06710 (LG304_06695)	-	1328031..1328345 (+)	315	WP_058611614.1	MTH1187 family thiamine-binding protein	-
LG304_RS06715 (LG304_06700)	-	1328375..1328614 (-)	240	WP_016911885.1	DUF2759 domain-containing protein	-
LG304_RS06720 (LG304_06705)	-	1328712..1329344 (+)	633	WP_058611613.1	MBL fold metallo-hydrolase	-
LG304_RS06725 (LG304_06710)	-	1329378..1329626 (-)	249	WP_025904960.1	DUF2626 family protein	-
LG304_RS06730 (LG304_06715)	comGA	1329780..1330682 (+)	903	WP_404398798.1	competence type IV pilus ATPase ComGA	Machinery gene
LG304_RS06735 (LG304_06720)	comGB	1330672..1331712 (+)	1041	WP_077152202.1	competence type IV pilus assembly protein ComGB	-
LG304_RS06740 (LG304_06725)	comGC	1331727..1332044 (+)	318	WP_058611611.1	competence type IV pilus major pilin ComGC	Machinery gene
LG304_RS06745 (LG304_06730)	comGD	1332025..1332471 (+)	447	WP_227531649.1	competence type IV pilus minor pilin ComGD	-
LG304_RS06750 (LG304_06735)	comGE	1332455..1332736 (+)	282	WP_404398801.1	competence type IV pilus minor pilin ComGE	-
LG304_RS06755 (LG304_06740)	-	1332711..1333145 (+)	435	WP_404398803.1	competence type IV pilus minor pilin ComGF	-
LG304_RS06760 (LG304_06745)	-	1333380..1333868 (+)	489	WP_096791892.1	shikimate kinase	-
LG304_RS06765 (LG304_06750)	gcvT	1334061..1335149 (+)	1089	WP_404398805.1	glycine cleavage system aminomethyltransferase GcvT	-
LG304_RS06770 (LG304_06755)	gcvPA	1335161..1336504 (+)	1344	WP_404398807.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11605.67 Da
• Isoelectric Point: 8.5043

>NTDB_id=616696 LG304_RS06740 WP_058611611.1 1331727..1332044(+) (comGC) [Mammaliicoccus sciuri strain ABH-485]
MKRFKFLSKKEGFTLVEMLIVLLIISILLVIIIPNISKQSETVKSTGCQAQVKMVAGQVEAYTLKHDAKPNSINDLISDG
YINQKQLTCKSGETITLENGEVVAH

Nucleotide

• Length: 318 bp

>NTDB_id=616696 LG304_RS06740 WP_058611611.1 1331727..1332044(+) (comGC) [Mammaliicoccus sciuri strain ABH-485]
ATGAAAAGATTTAAATTTTTAAGTAAAAAAGAAGGGTTTACATTGGTTGAAATGTTAATTGTCCTTTTAATCATAAGTAT
ATTATTGGTGATCATCATACCAAACATCAGCAAGCAATCAGAGACGGTAAAAAGTACTGGATGCCAAGCACAAGTGAAAA
TGGTAGCTGGTCAAGTAGAAGCTTATACATTGAAACACGATGCTAAACCAAATTCTATAAATGATTTAATAAGTGATGGC
TATATTAACCAAAAGCAACTGACTTGTAAATCAGGAGAAACAATTACGCTAGAAAACGGTGAAGTTGTTGCACATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-32)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	65.686	97.143	0.638
comGC	Staphylococcus aureus MW2	65.686	97.143	0.638
comGC	Bacillus subtilis subsp. subtilis str. 168	47.312	88.571	0.419
comYC	Streptococcus mutans UA159	48.276	82.857	0.4
comYC	Streptococcus mutans UA140	48.276	82.857	0.4
comYC	Streptococcus gordonii str. Challis substr. CH1	47.674	81.905	0.39
comGC/cglC	Streptococcus mitis NCTC 12261	46.988	79.048	0.371
comGC/cglC	Streptococcus mitis SK321	46.988	79.048	0.371
comGC	Lactococcus lactis subsp. cremoris KW2	46.914	77.143	0.362
comYC	Streptococcus suis isolate S10	48.718	74.286	0.362