Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   LG306_RS13615 Genome accession   NZ_CP085234
Coordinates   2683462..2683908 (+) Length   148 a.a.
NCBI ID   WP_404415485.1    Uniprot ID   -
Organism   Brevundimonas vesicularis strain ADH2-360     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2667025..2710651 2683462..2683908 within 0


Gene organization within MGE regions


Location: 2667025..2710651
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LG306_RS13440 (LG306_13400) - 2667025..2667510 (-) 486 WP_082064365.1 GIY-YIG nuclease family protein -
  LG306_RS13445 (LG306_13405) xerC 2667553..2668389 (-) 837 WP_404415397.1 tyrosine recombinase XerC -
  LG306_RS13450 (LG306_13410) - 2668566..2668808 (-) 243 WP_404415400.1 helix-turn-helix transcriptional regulator -
  LG306_RS13455 (LG306_13415) - 2668805..2669098 (-) 294 WP_404415403.1 hypothetical protein -
  LG306_RS13460 (LG306_13420) - 2669095..2669508 (-) 414 WP_404415405.1 hypothetical protein -
  LG306_RS13465 (LG306_13425) - 2669505..2669852 (-) 348 WP_404415408.1 hypothetical protein -
  LG306_RS13470 (LG306_13430) - 2669849..2670196 (-) 348 WP_404415410.1 hypothetical protein -
  LG306_RS13475 (LG306_13435) - 2670193..2670588 (-) 396 WP_404415413.1 hypothetical protein -
  LG306_RS13480 (LG306_13440) - 2670650..2671273 (-) 624 WP_404419770.1 hypothetical protein -
  LG306_RS13485 (LG306_13445) - 2671332..2671778 (-) 447 Protein_2643 DNA cytosine methyltransferase -
  LG306_RS13490 (LG306_13450) - 2671775..2673178 (-) 1404 WP_404415416.1 Lar family restriction alleviation protein -
  LG306_RS13495 (LG306_13455) - 2673175..2673933 (-) 759 WP_404415419.1 hypothetical protein -
  LG306_RS13500 (LG306_13460) - 2673930..2674268 (-) 339 WP_404415422.1 6-carboxytetrahydropterin synthase -
  LG306_RS13505 (LG306_13465) - 2674268..2674501 (-) 234 WP_404415425.1 hypothetical protein -
  LG306_RS13510 (LG306_13470) - 2674501..2674878 (-) 378 WP_404415428.1 hypothetical protein -
  LG306_RS13515 (LG306_13475) - 2674882..2675256 (-) 375 WP_404415431.1 HNH endonuclease -
  LG306_RS13520 (LG306_13480) - 2675256..2675768 (-) 513 WP_404415433.1 hypothetical protein -
  LG306_RS13525 (LG306_13485) bet 2675765..2676682 (-) 918 WP_404415436.1 phage recombination protein Bet -
  LG306_RS13530 (LG306_13490) - 2676679..2677269 (-) 591 WP_404415439.1 siphovirus Gp157 family protein -
  LG306_RS13535 (LG306_13495) - 2677170..2677670 (-) 501 WP_404415441.1 HNH endonuclease signature motif containing protein -
  LG306_RS13540 (LG306_13500) - 2677802..2678044 (-) 243 WP_404415444.1 hypothetical protein -
  LG306_RS13545 (LG306_13505) - 2678041..2678457 (-) 417 WP_404415447.1 hypothetical protein -
  LG306_RS13550 (LG306_13510) - 2678454..2678768 (-) 315 WP_404415449.1 hypothetical protein -
  LG306_RS13555 (LG306_13515) - 2678765..2679208 (-) 444 WP_404415452.1 hypothetical protein -
  LG306_RS13560 (LG306_13520) - 2679205..2679624 (-) 420 WP_404415455.1 hypothetical protein -
  LG306_RS13565 (LG306_13525) - 2679745..2680026 (+) 282 WP_404415457.1 hypothetical protein -
  LG306_RS13570 (LG306_13530) - 2680053..2681000 (-) 948 WP_404415460.1 hypothetical protein -
  LG306_RS13575 (LG306_13535) - 2680997..2681623 (-) 627 WP_404415463.1 helix-turn-helix transcriptional regulator -
  LG306_RS13580 - 2681708..2681956 (+) 249 WP_404415466.1 carph-isopro domain-containing protein -
  LG306_RS13585 (LG306_13540) - 2681953..2682105 (+) 153 WP_404415469.1 hypothetical protein -
  LG306_RS13590 (LG306_13545) - 2682109..2682273 (+) 165 WP_404415471.1 hypothetical protein -
  LG306_RS13595 (LG306_13550) - 2682324..2682767 (+) 444 WP_404415474.1 hypothetical protein -
  LG306_RS13600 (LG306_13555) - 2682767..2683054 (+) 288 WP_404415477.1 hypothetical protein -
  LG306_RS13605 (LG306_13560) - 2683051..2683278 (+) 228 WP_404415479.1 hypothetical protein -
  LG306_RS13610 (LG306_13565) - 2683275..2683460 (+) 186 WP_404415482.1 hypothetical protein -
  LG306_RS13615 (LG306_13570) ssb 2683462..2683908 (+) 447 WP_404415485.1 single-stranded DNA-binding protein Machinery gene
  LG306_RS13620 - 2683921..2684307 (+) 387 WP_404415488.1 helix-turn-helix domain-containing protein -
  LG306_RS13625 (LG306_13580) thyX 2684304..2684978 (+) 675 WP_404415490.1 FAD-dependent thymidylate synthase -
  LG306_RS13630 (LG306_13585) - 2684993..2685295 (+) 303 WP_404415493.1 hypothetical protein -
  LG306_RS13635 (LG306_13590) - 2685292..2685534 (+) 243 WP_404415495.1 hypothetical protein -
  LG306_RS13640 (LG306_13595) - 2685531..2686268 (+) 738 WP_404415498.1 DUF1376 domain-containing protein -
  LG306_RS13645 (LG306_13600) - 2686458..2687960 (+) 1503 WP_404415501.1 AAA family ATPase -
  LG306_RS13650 (LG306_13605) - 2688148..2688864 (+) 717 WP_404415503.1 hypothetical protein -
  LG306_RS13655 (LG306_13610) - 2688998..2689207 (+) 210 WP_404415506.1 hypothetical protein -
  LG306_RS13660 (LG306_13615) - 2689217..2689408 (+) 192 WP_404415509.1 hypothetical protein -
  LG306_RS13665 (LG306_13620) - 2689421..2690011 (+) 591 WP_404415512.1 hypothetical protein -
  LG306_RS13670 (LG306_13625) - 2689941..2691278 (+) 1338 WP_404415515.1 DNA-packaging protein -
  LG306_RS13675 (LG306_13630) - 2691268..2692674 (+) 1407 WP_404415518.1 DUF4055 domain-containing protein -
  LG306_RS13680 (LG306_13635) - 2692674..2693666 (+) 993 WP_404415521.1 minor capsid protein -
  LG306_RS13685 (LG306_13640) - 2694020..2694613 (+) 594 WP_404415524.1 hypothetical protein -
  LG306_RS13690 (LG306_13645) - 2694667..2695680 (+) 1014 WP_404415527.1 major capsid protein -
  LG306_RS13695 (LG306_13650) - 2695738..2695938 (+) 201 WP_404415529.1 hypothetical protein -
  LG306_RS13700 (LG306_13655) - 2695942..2696367 (+) 426 WP_404415532.1 hypothetical protein -
  LG306_RS13705 (LG306_13660) - 2696364..2696714 (+) 351 WP_404415534.1 hypothetical protein -
  LG306_RS13710 (LG306_13665) - 2696714..2697109 (+) 396 WP_404415537.1 hypothetical protein -
  LG306_RS13715 (LG306_13670) - 2697106..2697534 (+) 429 WP_404415540.1 hypothetical protein -
  LG306_RS13720 (LG306_13675) - 2697537..2697977 (+) 441 WP_404415543.1 phage tail tube protein -
  LG306_RS13725 (LG306_13680) - 2697977..2698357 (+) 381 WP_404415545.1 hypothetical protein -
  LG306_RS13730 (LG306_13685) - 2698606..2698950 (+) 345 WP_404415548.1 hypothetical protein -
  LG306_RS13735 (LG306_13690) - 2699014..2701218 (+) 2205 WP_404415550.1 hypothetical protein -
  LG306_RS13740 (LG306_13695) - 2701218..2701799 (+) 582 WP_404415553.1 hypothetical protein -
  LG306_RS13745 (LG306_13700) - 2701799..2702431 (+) 633 WP_404415555.1 hypothetical protein -
  LG306_RS13750 (LG306_13705) - 2702440..2702865 (+) 426 WP_404415557.1 DUF6950 family protein -
  LG306_RS13755 (LG306_13710) - 2702866..2705109 (+) 2244 WP_404415560.1 hypothetical protein -
  LG306_RS13760 (LG306_13715) - 2705124..2705516 (+) 393 WP_404415563.1 hypothetical protein -
  LG306_RS13765 (LG306_13720) - 2705516..2707588 (+) 2073 WP_404415565.1 discoidin domain-containing protein -
  LG306_RS13770 (LG306_13725) - 2707666..2708145 (+) 480 WP_404415568.1 hypothetical protein -
  LG306_RS13775 (LG306_13730) - 2708147..2708353 (+) 207 WP_374322138.1 hypothetical protein -
  LG306_RS13780 (LG306_13735) - 2708818..2709438 (+) 621 WP_404415571.1 glycoside hydrolase family 19 protein -
  LG306_RS13785 (LG306_13740) - 2709435..2709812 (+) 378 WP_404415574.1 hypothetical protein -
  LG306_RS13790 (LG306_13745) - 2710055..2710651 (+) 597 WP_404415577.1 hypothetical protein -

Sequence


Protein


Download         Length: 148 a.a.        Molecular weight: 16370.21 Da        Isoelectric Point: 5.9367

>NTDB_id=616187 LG306_RS13615 WP_404415485.1 2683462..2683908(+) (ssb) [Brevundimonas vesicularis strain ADH2-360]
MAGSVNKVILVGNLGRDPEIRTMQNGDRVANLSLATSESWRDKSSGERKEKTEWHRVTVFNEGIVKVCENYLKKGSTIYV
EGQLQTRKWTDQQGVEKYSTEIVLKPFNGVLTMLGGAPSGEGQRSAATSDNQSSGPRDSYDLNDDIPF

Nucleotide


Download         Length: 447 bp        

>NTDB_id=616187 LG306_RS13615 WP_404415485.1 2683462..2683908(+) (ssb) [Brevundimonas vesicularis strain ADH2-360]
ATGGCCGGCAGCGTCAACAAGGTCATCTTGGTCGGCAACCTCGGGCGCGACCCCGAAATCCGCACGATGCAGAACGGCGA
CCGCGTCGCCAACCTCAGCCTCGCCACCTCCGAGAGCTGGCGGGACAAGTCCTCCGGCGAGCGCAAGGAGAAGACCGAGT
GGCACCGCGTCACGGTCTTCAACGAGGGCATCGTCAAGGTCTGCGAGAATTACCTGAAGAAGGGCTCGACCATCTACGTC
GAGGGCCAGCTTCAGACCCGCAAATGGACTGATCAGCAGGGCGTCGAGAAGTACTCGACGGAGATCGTGCTGAAGCCGTT
CAACGGCGTCCTGACCATGCTCGGCGGCGCGCCCTCCGGTGAGGGCCAGCGGTCTGCCGCCACTTCCGACAACCAGTCCT
CAGGTCCGCGCGACAGCTACGACCTGAACGACGACATTCCGTTCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

46.821

100

0.547

  ssb Glaesserella parasuis strain SC1401

51.923

100

0.547

  ssb Neisseria gonorrhoeae MS11

38.286

100

0.453

  ssb Neisseria meningitidis MC58

38.286

100

0.453