Detailed information    

insolico Bioinformatically predicted

Overview

Name   pilF/pilF2   Type   Machinery gene
Locus tag   LIN96_RS00355 Genome accession   NZ_CP085090
Coordinates   74981..75532 (+) Length   183 a.a.
NCBI ID   WP_005547469.1    Uniprot ID   -
Organism   Aggregatibacter actinomycetemcomitans strain 31R     
Function   type IV pilus biogenesis and function (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 290..77965 74981..75532 within 0


Gene organization within MGE regions


Location: 290..77965
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LIN96_RS00010 dnaN 1373..2473 (+) 1101 WP_005589012.1 DNA polymerase III subunit beta -
  LIN96_RS00015 recF 2477..3553 (+) 1077 WP_005547246.1 DNA replication/repair protein RecF -
  LIN96_RS00020 - 3600..4355 (-) 756 WP_005566829.1 class I SAM-dependent methyltransferase -
  LIN96_RS00025 sodC 4543..5118 (+) 576 WP_005547254.1 superoxide dismutase family protein -
  LIN96_RS00030 - 5219..5558 (+) 340 Protein_5 helix-turn-helix domain-containing protein -
  LIN96_RS00035 - 5555..6361 (+) 807 WP_249847582.1 IS3 family transposase -
  LIN96_RS00040 - 6571..6822 (-) 252 WP_005546544.1 helix-turn-helix transcriptional regulator -
  LIN96_RS00045 - 6973..8397 (+) 1425 WP_025298046.1 NAD-dependent malic enzyme -
  LIN96_RS00050 - 8500..10335 (+) 1836 WP_025298047.1 hypothetical protein -
  LIN96_RS00055 - 10345..10710 (+) 366 WP_025298048.1 hypothetical protein -
  LIN96_RS00060 - 10691..11821 (+) 1131 WP_025298049.1 hypothetical protein -
  LIN96_RS00065 - 11840..12886 (+) 1047 WP_249847512.1 dsDNA nuclease domain-containing protein -
  LIN96_RS00070 - 12940..14550 (+) 1611 WP_249847515.1 hypothetical protein -
  LIN96_RS00075 - 14813..17680 (+) 2868 WP_233115221.1 UvrD-helicase domain-containing protein -
  LIN96_RS00080 - 17716..18948 (+) 1233 WP_233112715.1 tetratricopeptide repeat protein -
  LIN96_RS00085 - 19152..19364 (+) 213 WP_025298054.1 helix-turn-helix transcriptional regulator -
  LIN96_RS00090 - 19376..20050 (+) 675 WP_025298055.1 hypothetical protein -
  LIN96_RS00095 - 20130..20603 (-) 474 WP_025298056.1 hypothetical protein -
  LIN96_RS00100 - 20733..23354 (-) 2622 WP_025298057.1 DEAD/DEAH box helicase family protein -
  LIN96_RS00105 - 23364..25004 (-) 1641 WP_025298058.1 site-specific DNA-methyltransferase -
  LIN96_RS00110 - 25017..25229 (-) 213 WP_005548214.1 hypothetical protein -
  LIN96_RS00115 - 25350..26804 (-) 1455 WP_249847516.1 hypothetical protein -
  LIN96_RS00120 - 26765..27883 (-) 1119 WP_233112712.1 TniQ family protein -
  LIN96_RS00125 - 27841..28734 (-) 894 WP_025298059.1 TniB family NTP-binding protein -
  LIN96_RS00130 - 28734..30647 (-) 1914 WP_233117531.1 Mu transposase C-terminal domain-containing protein -
  LIN96_RS00135 - 30640..31299 (-) 660 WP_233114705.1 TnsA endonuclease N-terminal domain-containing protein -
  LIN96_RS00140 nrfF 31508..32557 (-) 1050 WP_005568599.1 heme lyase NrfEFG subunit NrfF -
  LIN96_RS00145 - 32554..33084 (-) 531 WP_012821113.1 DsbE family thiol:disulfide interchange protein -
  LIN96_RS00150 nrfE 33077..34987 (-) 1911 WP_005568601.1 heme lyase NrfEFG subunit NrfE -
  LIN96_RS00155 nrfD 35574..36539 (-) 966 WP_005572112.1 cytochrome c nitrite reductase subunit NrfD -
  LIN96_RS00160 nrfC 36536..37213 (-) 678 WP_005547396.1 cytochrome c nitrite reductase Fe-S protein -
  LIN96_RS00165 nrfB 37210..37875 (-) 666 WP_005568063.1 cytochrome c nitrite reductase pentaheme subunit -
  LIN96_RS00170 nrfA 37949..39472 (-) 1524 WP_249847518.1 ammonia-forming nitrite reductase cytochrome c552 subunit -
  LIN96_RS00175 - 40049..40339 (-) 291 WP_005547402.1 hypothetical protein -
  LIN96_RS00180 - 40357..40983 (-) 627 WP_005547404.1 hypothetical protein -
  LIN96_RS00185 ccmI 41115..42038 (-) 924 WP_005568059.1 c-type cytochrome biogenesis protein CcmI -
  LIN96_RS00190 - 42038..42589 (-) 552 WP_005547408.1 cytochrome c-type biogenesis protein -
  LIN96_RS00195 - 42589..43134 (-) 546 WP_005542796.1 DsbE family thiol:disulfide interchange protein -
  LIN96_RS00200 - 43163..45121 (-) 1959 WP_005568055.1 heme lyase CcmF/NrfE family subunit -
  LIN96_RS00205 ccmE 45121..45639 (-) 519 WP_005547412.1 cytochrome c maturation protein CcmE -
  LIN96_RS00210 ccmD 45636..45842 (-) 207 WP_005574716.1 heme exporter protein CcmD -
  LIN96_RS00215 - 45860..46597 (-) 738 WP_005547415.1 heme ABC transporter permease -
  LIN96_RS00220 ccmB 46608..47273 (-) 666 WP_025298064.1 heme exporter protein CcmB -
  LIN96_RS00225 ccmA 47278..47913 (-) 636 WP_005570189.1 cytochrome c biogenesis heme-transporting ATPase CcmA -
  LIN96_RS00230 - 48085..49278 (-) 1194 WP_005568048.1 Bcr/CflA family multidrug efflux MFS transporter -
  LIN96_RS00235 rsuA 49283..49984 (-) 702 WP_005568046.1 16S rRNA pseudouridine(516) synthase RsuA -
  LIN96_RS00240 - 50201..52465 (+) 2265 WP_005568044.1 NADP-dependent malic enzyme -
  LIN96_RS00245 - 52609..53253 (+) 645 WP_005564490.1 Fe-Mn family superoxide dismutase -
  LIN96_RS00250 - 53664..54455 (+) 792 WP_005568042.1 factor H-binding protein -
  LIN96_RS00255 - 54659..55486 (-) 828 WP_005568040.1 neutral zinc metallopeptidase -
  LIN96_RS00260 lysM 55626..56069 (+) 444 WP_014167416.1 peptidoglycan-binding protein LysM -
  LIN96_RS00265 plsY 56159..56755 (-) 597 WP_005543723.1 glycerol-3-phosphate 1-O-acyltransferase PlsY -
  LIN96_RS00270 folB 56852..57205 (+) 354 WP_005568036.1 dihydroneopterin aldolase -
  LIN96_RS00275 mltF 57226..58656 (+) 1431 WP_005568034.1 membrane-bound lytic murein transglycosylase MltF -
  LIN96_RS00280 - 58667..58813 (+) 147 WP_005543716.1 hypothetical protein -
  LIN96_RS00285 dsbB 58856..59395 (-) 540 WP_005568033.1 disulfide bond formation protein DsbB -
  LIN96_RS00290 nhaB 59419..60963 (-) 1545 WP_005543712.1 sodium/proton antiporter NhaB -
  LIN96_RS00295 fadR 61158..61889 (+) 732 WP_005568029.1 fatty acid metabolism transcriptional regulator FadR -
  LIN96_RS00300 - 62010..63224 (-) 1215 WP_025298065.1 pyridoxal phosphate-dependent aminotransferase -
  LIN96_RS00305 - 63341..64645 (+) 1305 WP_005547450.1 isochorismate synthase -
  LIN96_RS00310 menD 64636..66342 (+) 1707 WP_233112710.1 2-succinyl-5-enolpyruvyl-6-hydroxy-3- cyclohexene-1-carboxylic-acid synthase -
  LIN96_RS00315 menH 66395..67144 (+) 750 WP_005547454.1 2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate synthase -
  LIN96_RS00320 rpsO 67240..67509 (+) 270 WP_005540508.1 30S ribosomal protein S15 -
  LIN96_RS00325 metK 67717..68871 (+) 1155 WP_005547457.1 methionine adenosyltransferase -
  LIN96_RS00330 - 68940..69440 (+) 501 WP_005568024.1 SprT family zinc-dependent metalloprotease -
  LIN96_RS00335 - 69597..70838 (+) 1242 WP_005588266.1 HAAAP family serine/threonine permease -
  LIN96_RS00340 - 70931..72295 (+) 1365 WP_005547462.1 L-serine ammonia-lyase -
  LIN96_RS00345 ansB 72476..73525 (-) 1050 WP_005568022.1 L-asparaginase 2 -
  LIN96_RS00350 - 73820..74959 (+) 1140 WP_233113578.1 bifunctional tRNA (adenosine(37)-C2)-methyltransferase TrmG/ribosomal RNA large subunit methyltransferase RlmN -
  LIN96_RS00355 pilF/pilF2 74981..75532 (+) 552 WP_005547469.1 type IV pilus biogenesis/stability protein PilW Machinery gene
  LIN96_RS00360 - 75676..76731 (+) 1056 WP_005568019.1 RodZ family helix-turn-helix domain-containing protein -
  LIN96_RS00365 ispG 76743..77846 (+) 1104 WP_005542474.1 flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase -

Sequence

Protein


Download         Length: 183 a.a.        Molecular weight: 20667.46 Da        Isoelectric Point: 8.8869

>NTDB_id=615371 LIN96_RS00355 WP_005547469.1 74981..75532(+) (pilF/pilF2) [Aggregatibacter actinomycetemcomitans strain 31R]
MIKFQQHNRAIPFIFPFLLSACVTQQSAVDFDKQKAAKARVELALGYLQQQDSAQAKLNLDKAFSYAPDYYLVSAAFAYF
YQQQGDIEQARTAYLNAIKLDDKQGDVFNNYGAFLCAQGEFDSAYVQFERALKSSNYYHQADTYENLALCALSAKNQAIY
RQNLALLTKISPKRAAKLPQGIK

Nucleotide


Download         Length: 552 bp        

>NTDB_id=615371 LIN96_RS00355 WP_005547469.1 74981..75532(+) (pilF/pilF2) [Aggregatibacter actinomycetemcomitans strain 31R]
ATGATCAAATTTCAACAGCACAATCGTGCAATACCGTTTATTTTTCCGTTTTTGCTTTCCGCCTGCGTCACCCAACAAAG
TGCGGTGGATTTTGACAAGCAAAAAGCCGCCAAAGCACGCGTGGAACTGGCATTAGGCTATTTACAGCAGCAAGATTCGG
CACAAGCCAAGCTGAACCTGGATAAAGCCTTTTCTTACGCTCCCGATTATTATTTAGTGTCAGCGGCATTTGCCTATTTC
TATCAACAACAGGGCGACATTGAACAAGCCCGTACCGCCTATTTAAACGCGATAAAATTAGATGATAAACAAGGGGATGT
GTTCAATAATTACGGTGCATTTCTTTGTGCGCAAGGGGAATTCGACAGTGCCTATGTACAATTTGAACGCGCCTTAAAAA
GCTCGAATTATTACCATCAGGCGGACACTTATGAAAACTTGGCGTTATGTGCTTTATCCGCCAAAAATCAGGCGATTTAT
CGGCAAAATCTCGCATTATTGACGAAAATCTCTCCGAAACGGGCGGCAAAATTACCACAAGGGATAAAATAA

Domains

Predicted by InterproScan.

Tetratricopeptide repeat (TPR_8)

(78-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilF/pilF2 Haemophilus influenzae Rd KW20

57.576

90.164

0.519
  pilF Glaesserella parasuis strain SC1401

47.059

92.896

0.437