Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | LIO31_RS03200 | Genome accession | NZ_CP085086 |
| Coordinates | 615986..616519 (+) | Length | 177 a.a. |
| NCBI ID | WP_074412309.1 | Uniprot ID | - |
| Organism | Streptococcus suis strain Ssuis_MA6 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 607836..652033 | 615986..616519 | within | 0 |
Gene organization within MGE regions
Location: 607836..652033
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LIO31_RS03130 | - | 607836..608894 (-) | 1059 | WP_074412299.1 | site-specific integrase | - |
| LIO31_RS03135 | - | 609017..609841 (-) | 825 | WP_074412300.1 | hypothetical protein | - |
| LIO31_RS03140 | - | 609856..610173 (-) | 318 | WP_079267851.1 | ImmA/IrrE family metallo-endopeptidase | - |
| LIO31_RS03145 | - | 610220..610579 (-) | 360 | WP_024387645.1 | helix-turn-helix domain-containing protein | - |
| LIO31_RS03150 | - | 610885..611076 (+) | 192 | WP_074412301.1 | hypothetical protein | - |
| LIO31_RS03155 | - | 611084..611587 (+) | 504 | WP_141666876.1 | hypothetical protein | - |
| LIO31_RS03160 | - | 611602..611838 (+) | 237 | WP_074389229.1 | hypothetical protein | - |
| LIO31_RS03165 | - | 611831..612109 (+) | 279 | WP_074412303.1 | DNA-binding protein | - |
| LIO31_RS03170 | - | 612152..612487 (+) | 336 | WP_074412304.1 | transcriptional regulator | - |
| LIO31_RS03175 | - | 612729..613508 (+) | 780 | WP_074412305.1 | ParB N-terminal domain-containing protein | - |
| LIO31_RS03180 | - | 613522..614226 (+) | 705 | WP_074412306.1 | ERF family protein | - |
| LIO31_RS03185 | - | 614236..615297 (+) | 1062 | WP_074412307.1 | DUF1351 domain-containing protein | - |
| LIO31_RS03190 | - | 615287..615820 (+) | 534 | WP_074412308.1 | MazG-like family protein | - |
| LIO31_RS03195 | - | 615820..615996 (+) | 177 | WP_171841111.1 | hypothetical protein | - |
| LIO31_RS03200 | ssbA | 615986..616519 (+) | 534 | WP_074412309.1 | single-stranded DNA-binding protein | Machinery gene |
| LIO31_RS03205 | - | 616535..616813 (+) | 279 | WP_029752020.1 | hypothetical protein | - |
| LIO31_RS03210 | - | 616823..617602 (+) | 780 | WP_105130532.1 | DNA methyltransferase | - |
| LIO31_RS03215 | - | 617799..618278 (+) | 480 | WP_074412311.1 | helix-turn-helix domain-containing protein | - |
| LIO31_RS03220 | - | 618291..618728 (+) | 438 | WP_024383995.1 | hypothetical protein | - |
| LIO31_RS03225 | - | 618730..619464 (+) | 735 | WP_024410599.1 | hypothetical protein | - |
| LIO31_RS03230 | - | 619485..619859 (+) | 375 | WP_044767986.1 | hypothetical protein | - |
| LIO31_RS03235 | - | 620054..620905 (+) | 852 | WP_074392407.1 | prohibitin family protein | - |
| LIO31_RS03240 | - | 620906..621208 (+) | 303 | WP_014736101.1 | DUF1372 family protein | - |
| LIO31_RS03245 | - | 621209..621439 (+) | 231 | WP_014736100.1 | hypothetical protein | - |
| LIO31_RS03250 | - | 621432..621662 (+) | 231 | WP_074412312.1 | hypothetical protein | - |
| LIO31_RS03255 | - | 621659..622069 (+) | 411 | WP_074412313.1 | endodeoxyribonuclease RusA | - |
| LIO31_RS03260 | - | 622062..622298 (+) | 237 | WP_074412314.1 | hypothetical protein | - |
| LIO31_RS03265 | - | 622299..622679 (+) | 381 | WP_024384004.1 | hypothetical protein | - |
| LIO31_RS03270 | - | 622748..623419 (+) | 672 | WP_074412315.1 | DUF4417 domain-containing protein | - |
| LIO31_RS03275 | - | 623416..623799 (+) | 384 | WP_014736095.1 | hypothetical protein | - |
| LIO31_RS03280 | - | 623991..624470 (+) | 480 | WP_044767977.1 | terminase small subunit | - |
| LIO31_RS03285 | - | 624457..625770 (+) | 1314 | WP_074412316.1 | PBSX family phage terminase large subunit | - |
| LIO31_RS03290 | - | 625782..627371 (+) | 1590 | WP_074412317.1 | phage portal protein | - |
| LIO31_RS03295 | - | 627358..627612 (+) | 255 | WP_074412318.1 | hypothetical protein | - |
| LIO31_RS03300 | - | 627615..628766 (+) | 1152 | WP_074412319.1 | phage minor capsid protein | - |
| LIO31_RS03305 | - | 628913..629530 (+) | 618 | WP_074412320.1 | phage scaffolding protein | - |
| LIO31_RS03310 | - | 629534..630373 (+) | 840 | WP_016056180.1 | N4-gp56 family major capsid protein | - |
| LIO31_RS03315 | - | 630373..630558 (+) | 186 | WP_074412321.1 | Rho termination factor N-terminal domain-containing protein | - |
| LIO31_RS03320 | - | 630536..630763 (+) | 228 | WP_024410586.1 | hypothetical protein | - |
| LIO31_RS03325 | - | 630805..631200 (+) | 396 | WP_074412322.1 | hypothetical protein | - |
| LIO31_RS03330 | - | 631190..631516 (+) | 327 | WP_014736085.1 | putative minor capsid protein | - |
| LIO31_RS03335 | - | 631516..631866 (+) | 351 | WP_074412323.1 | minor capsid protein | - |
| LIO31_RS03340 | - | 631866..632273 (+) | 408 | WP_074412324.1 | minor capsid protein | - |
| LIO31_RS03345 | - | 632278..632736 (+) | 459 | WP_014736082.1 | phage tail tube protein | - |
| LIO31_RS03350 | - | 632759..633127 (+) | 369 | WP_029751986.1 | hypothetical protein | - |
| LIO31_RS03355 | - | 633127..633714 (+) | 588 | WP_074412325.1 | Gp15 family bacteriophage protein | - |
| LIO31_RS03360 | - | 633734..637096 (+) | 3363 | WP_074412326.1 | hypothetical protein | - |
| LIO31_RS03365 | - | 637093..638595 (+) | 1503 | WP_074412327.1 | distal tail protein Dit | - |
| LIO31_RS03370 | - | 638595..642437 (+) | 3843 | WP_226960927.1 | phage tail protein | - |
| LIO31_RS03375 | - | 642451..644505 (+) | 2055 | WP_074412329.1 | DUF859 family phage minor structural protein | - |
| LIO31_RS03380 | - | 644567..644830 (+) | 264 | WP_024410576.1 | hypothetical protein | - |
| LIO31_RS03385 | - | 644855..645298 (+) | 444 | WP_217452366.1 | hypothetical protein | - |
| LIO31_RS03390 | - | 645273..645476 (+) | 204 | WP_029751977.1 | phage holin | - |
| LIO31_RS03395 | - | 645606..646316 (+) | 711 | WP_074412330.1 | CHAP domain-containing protein | - |
| LIO31_RS03400 | hsdR | 646800..649124 (+) | 2325 | WP_012027389.1 | EcoAI/FtnUII family type I restriction enzme subunit R | - |
| LIO31_RS03405 | - | 649145..650218 (+) | 1074 | Protein_638 | class I SAM-dependent DNA methyltransferase | - |
| LIO31_RS03410 | - | 650218..650793 (+) | 576 | Protein_639 | restriction endonuclease subunit S | - |
Sequence
Protein
Download Length: 177 a.a. Molecular weight: 19679.34 Da Isoelectric Point: 5.1407
>NTDB_id=615216 LIO31_RS03200 WP_074412309.1 615986..616519(+) (ssbA) [Streptococcus suis strain Ssuis_MA6]
MINNVVLVGRLTRDAELRYTPSNVAVATFTLAVNRSFKNEAGEREADFINCVIWRQAAENLANWAKKGALIGITGNIQTR
HYDNQQGQRVYVTEVIASNFQLLESRNNQSGQQNQSNSFQNGNNSNSGNFQSGNNQGGYQSPFGNQSTPDFSRSNQQSFF
QGQTTNPMDISDDDLPF
MINNVVLVGRLTRDAELRYTPSNVAVATFTLAVNRSFKNEAGEREADFINCVIWRQAAENLANWAKKGALIGITGNIQTR
HYDNQQGQRVYVTEVIASNFQLLESRNNQSGQQNQSNSFQNGNNSNSGNFQSGNNQGGYQSPFGNQSTPDFSRSNQQSFF
QGQTTNPMDISDDDLPF
Nucleotide
Download Length: 534 bp
>NTDB_id=615216 LIO31_RS03200 WP_074412309.1 615986..616519(+) (ssbA) [Streptococcus suis strain Ssuis_MA6]
ATGATAAATAACGTTGTTTTAGTAGGGCGACTGACTAGAGATGCTGAATTAAGATATACACCATCAAATGTTGCAGTTGC
CACTTTTACCCTTGCAGTAAATCGCTCTTTCAAAAATGAGGCTGGTGAACGTGAGGCAGACTTTATCAATTGTGTAATTT
GGCGACAAGCAGCAGAAAACCTTGCTAATTGGGCTAAGAAAGGCGCGTTGATTGGTATTACAGGCAACATCCAAACACGC
CACTATGACAATCAACAAGGGCAGCGCGTGTATGTGACAGAAGTTATTGCAAGTAATTTTCAATTGTTGGAAAGTCGGAA
CAATCAAAGCGGACAGCAGAACCAGAGCAACTCTTTCCAAAATGGAAATAACTCAAATAGTGGTAATTTCCAAAGTGGAA
ACAACCAAGGAGGCTATCAGTCTCCATTTGGAAATCAATCCACACCAGATTTTAGCCGTAGCAACCAACAATCATTTTTC
CAAGGACAAACCACAAATCCTATGGATATTTCCGATGATGATTTACCTTTCTAG
ATGATAAATAACGTTGTTTTAGTAGGGCGACTGACTAGAGATGCTGAATTAAGATATACACCATCAAATGTTGCAGTTGC
CACTTTTACCCTTGCAGTAAATCGCTCTTTCAAAAATGAGGCTGGTGAACGTGAGGCAGACTTTATCAATTGTGTAATTT
GGCGACAAGCAGCAGAAAACCTTGCTAATTGGGCTAAGAAAGGCGCGTTGATTGGTATTACAGGCAACATCCAAACACGC
CACTATGACAATCAACAAGGGCAGCGCGTGTATGTGACAGAAGTTATTGCAAGTAATTTTCAATTGTTGGAAAGTCGGAA
CAATCAAAGCGGACAGCAGAACCAGAGCAACTCTTTCCAAAATGGAAATAACTCAAATAGTGGTAATTTCCAAAGTGGAA
ACAACCAAGGAGGCTATCAGTCTCCATTTGGAAATCAATCCACACCAGATTTTAGCCGTAGCAACCAACAATCATTTTTC
CAAGGACAAACCACAAATCCTATGGATATTTCCGATGATGATTTACCTTTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.396 |
100 |
0.559 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
54.802 |
100 |
0.548 |