Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   NQZ84_RS07175 Genome accession   NZ_CP102094
Coordinates   1458071..1458307 (-) Length   78 a.a.
NCBI ID   WP_024407030.1    Uniprot ID   -
Organism   Streptococcus suis strain 12RC1     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context


Location: 1453071..1463307
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NQZ84_RS07145 (NQZ84_07145) - 1454004..1454594 (-) 591 WP_032498693.1 YitT family protein -
  NQZ84_RS07150 (NQZ84_07150) - 1454675..1455058 (-) 384 WP_002936200.1 PH domain-containing protein -
  NQZ84_RS07155 (NQZ84_07155) - 1455286..1456038 (+) 753 WP_044677455.1 hypothetical protein -
  NQZ84_RS07160 (NQZ84_07160) - 1456148..1456414 (-) 267 WP_044677454.1 hypothetical protein -
  NQZ84_RS07165 (NQZ84_07165) - 1456578..1456781 (-) 204 WP_044677453.1 hypothetical protein -
  NQZ84_RS07170 (NQZ84_07170) - 1457626..1458048 (-) 423 WP_024407031.1 hypothetical protein -
  NQZ84_RS07175 (NQZ84_07175) cipB 1458071..1458307 (-) 237 WP_024407030.1 Blp family class II bacteriocin Regulator
  NQZ84_RS07180 (NQZ84_07180) comB 1458495..1459856 (-) 1362 WP_257048476.1 bacteriocin secretion accessory protein Regulator
  NQZ84_RS07185 (NQZ84_07185) comA 1459866..1462016 (-) 2151 WP_044680882.1 peptide cleavage/export ABC transporter ComA Regulator
  NQZ84_RS07190 (NQZ84_07190) - 1462120..1462311 (-) 192 WP_044680883.1 hypothetical protein -
  NQZ84_RS07195 (NQZ84_07195) - 1462337..1462534 (-) 198 WP_044680884.1 hypothetical protein -
  NQZ84_RS07200 (NQZ84_07200) - 1462547..1462750 (-) 204 WP_044680885.1 hypothetical protein -
  NQZ84_RS07205 (NQZ84_07205) - 1462927..1463052 (-) 126 WP_141590538.1 bacteriocin -
  NQZ84_RS07210 (NQZ84_07210) - 1463063..1463206 (-) 144 WP_205029660.1 hypothetical protein -

Sequence


Protein


Download         Length: 78 a.a.        Molecular weight: 7894.09 Da        Isoelectric Point: 4.3240

>NTDB_id=614712 NQZ84_RS07175 WP_024407030.1 1458071..1458307(-) (cipB) [Streptococcus suis strain 12RC1]
MNTNFTNRFDVMTADMLLDIEGGKVDWKRVGQCALSIGIGASEAYMATAGGTMFLGPYAIGTGAVGAVIGGIGGSLTC

Nucleotide


Download         Length: 237 bp        

>NTDB_id=614712 NQZ84_RS07175 WP_024407030.1 1458071..1458307(-) (cipB) [Streptococcus suis strain 12RC1]
ATGAATACAAATTTTACTAACCGATTTGATGTAATGACTGCAGATATGCTTTTGGATATTGAAGGTGGGAAAGTTGATTG
GAAACGTGTGGGACAATGTGCATTAAGTATTGGTATTGGAGCTAGTGAAGCCTATATGGCCACTGCAGGGGGAACCATGT
TCTTAGGACCCTATGCTATTGGAACTGGTGCTGTAGGTGCAGTAATCGGAGGAATTGGAGGATCGTTAACTTGTTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.667

76.923

0.397