Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   LG401_RS14395 Genome accession   NZ_CP084711
Coordinates   2820109..2820249 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus pumilus strain AR03     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2815109..2825249
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LG401_RS14370 (LG401_14370) - 2815376..2815765 (-) 390 WP_003213775.1 hotdog fold thioesterase -
  LG401_RS14375 (LG401_14375) comA 2815789..2816430 (-) 642 WP_060597210.1 response regulator transcription factor Regulator
  LG401_RS14380 (LG401_14380) - 2816511..2818822 (-) 2312 Protein_2783 ATP-binding protein -
  LG401_RS14385 (LG401_14385) comX 2818879..2819046 (-) 168 WP_081311380.1 competence pheromone ComX -
  LG401_RS14390 (LG401_14390) - 2819043..2819957 (-) 915 WP_081311379.1 polyprenyl synthetase family protein -
  LG401_RS14395 (LG401_14395) degQ 2820109..2820249 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  LG401_RS14400 (LG401_14400) - 2820755..2821108 (+) 354 WP_226509205.1 inner spore coat protein -
  LG401_RS14405 (LG401_14405) - 2821142..2822368 (-) 1227 WP_106072124.1 EAL and HDOD domain-containing protein -
  LG401_RS14410 (LG401_14410) - 2822507..2823976 (-) 1470 WP_034659831.1 nicotinate phosphoribosyltransferase -
  LG401_RS14415 (LG401_14415) - 2823994..2824545 (-) 552 WP_060597218.1 cysteine hydrolase family protein -
  LG401_RS14420 (LG401_14420) - 2824606..2825013 (-) 408 WP_060597219.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=612642 LG401_RS14395 WP_003213123.1 2820109..2820249(-) (degQ) [Bacillus pumilus strain AR03]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=612642 LG401_RS14395 WP_003213123.1 2820109..2820249(-) (degQ) [Bacillus pumilus strain AR03]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696