Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   LDB25_RS13190 Genome accession   NZ_CP084695
Coordinates   2659177..2659350 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain DJB5     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2654177..2664350
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LDB25_RS13175 (LDB25_13140) gcvT 2654990..2656090 (-) 1101 WP_014418366.1 glycine cleavage system aminomethyltransferase GcvT -
  LDB25_RS13180 (LDB25_13145) - 2656514..2658184 (+) 1671 WP_021494309.1 DEAD/DEAH box helicase -
  LDB25_RS13185 (LDB25_13150) - 2658206..2659000 (+) 795 WP_014418368.1 YqhG family protein -
  LDB25_RS13190 (LDB25_13155) sinI 2659177..2659350 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  LDB25_RS13195 (LDB25_13160) sinR 2659384..2659719 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LDB25_RS13200 (LDB25_13165) tasA 2659767..2660552 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  LDB25_RS13205 (LDB25_13170) sipW 2660617..2661201 (-) 585 WP_014418370.1 signal peptidase I SipW -
  LDB25_RS13210 (LDB25_13175) tapA 2661173..2661844 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  LDB25_RS13215 (LDB25_13180) - 2662103..2662432 (+) 330 WP_014418372.1 DUF3889 domain-containing protein -
  LDB25_RS13220 (LDB25_13185) - 2662473..2662652 (-) 180 WP_003153093.1 YqzE family protein -
  LDB25_RS13225 (LDB25_13190) comGG 2662709..2663086 (-) 378 WP_014418373.1 competence type IV pilus minor pilin ComGG Machinery gene
  LDB25_RS13230 (LDB25_13195) comGF 2663087..2663587 (-) 501 WP_014418374.1 competence type IV pilus minor pilin ComGF -
  LDB25_RS13235 (LDB25_13200) comGE 2663496..2663810 (-) 315 WP_032863566.1 competence type IV pilus minor pilin ComGE Machinery gene
  LDB25_RS13240 (LDB25_13205) comGD 2663794..2664231 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=612469 LDB25_RS13190 WP_014418369.1 2659177..2659350(+) (sinI) [Bacillus velezensis strain DJB5]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=612469 LDB25_RS13190 WP_014418369.1 2659177..2659350(+) (sinI) [Bacillus velezensis strain DJB5]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719