Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   LDB25_RS13235 Genome accession   NZ_CP084695
Coordinates   2663496..2663810 (-) Length   104 a.a.
NCBI ID   WP_032863566.1    Uniprot ID   -
Organism   Bacillus velezensis strain DJB5     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2658496..2668810
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LDB25_RS13190 (LDB25_13155) sinI 2659177..2659350 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  LDB25_RS13195 (LDB25_13160) sinR 2659384..2659719 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LDB25_RS13200 (LDB25_13165) tasA 2659767..2660552 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  LDB25_RS13205 (LDB25_13170) sipW 2660617..2661201 (-) 585 WP_014418370.1 signal peptidase I SipW -
  LDB25_RS13210 (LDB25_13175) tapA 2661173..2661844 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  LDB25_RS13215 (LDB25_13180) - 2662103..2662432 (+) 330 WP_014418372.1 DUF3889 domain-containing protein -
  LDB25_RS13220 (LDB25_13185) - 2662473..2662652 (-) 180 WP_003153093.1 YqzE family protein -
  LDB25_RS13225 (LDB25_13190) comGG 2662709..2663086 (-) 378 WP_014418373.1 competence type IV pilus minor pilin ComGG Machinery gene
  LDB25_RS13230 (LDB25_13195) comGF 2663087..2663587 (-) 501 WP_014418374.1 competence type IV pilus minor pilin ComGF -
  LDB25_RS13235 (LDB25_13200) comGE 2663496..2663810 (-) 315 WP_032863566.1 competence type IV pilus minor pilin ComGE Machinery gene
  LDB25_RS13240 (LDB25_13205) comGD 2663794..2664231 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  LDB25_RS13245 (LDB25_13210) comGC 2664221..2664529 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  LDB25_RS13250 (LDB25_13215) comGB 2664534..2665571 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  LDB25_RS13255 (LDB25_13220) comGA 2665558..2666628 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  LDB25_RS13260 (LDB25_13225) - 2666821..2667771 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11920.92 Da        Isoelectric Point: 5.8321

>NTDB_id=612472 LDB25_RS13235 WP_032863566.1 2663496..2663810(-) (comGE) [Bacillus velezensis strain DJB5]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMMTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPDVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=612472 LDB25_RS13235 WP_032863566.1 2663496..2663810(-) (comGE) [Bacillus velezensis strain DJB5]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACGCTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGATGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGATGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGTGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

44.348

100

0.49